CAZyme Information: MGYG000001756_00302

Basic Information

• Species: UBA1394 sp900538575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1394; UBA1394 sp900538575
• CAZyme ID: MGYG000001756_00302
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
879		97050.14	4.4724

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001756	2438245	MAG	Iceland	Europe

• Gene Location: Start: 2375; End: 5014 Strand: -

Full Sequence      

MTDNKSNRHSSGNSGNRQSRKPSDNHKRDNVSRQRSPYAAYSGGGKYPDKKQTQPRASGA
SGKTGNTAKSRSGSTGGRPPGKANTSAKHTPPNPQSRPTRKKPENKKAALAKKIAAIMGT
TLLSIFLVVVITGTIVATAMTVYVLEFMDETSDVTITELASSANTIVYANKGDKELVQLY
TVKNDVQRVPVDIEDIPQHVRDAFVCVEDERFYSHEGVDYKRTFAAFANMFIHIYDTNQG
GSTITQQLIKNLTGDDDPSPSRKIREIFRAMQFEKKYSKDVILENYLNYIGFGGPTNGIQ
LASIKYFGKDVADLSIAEAACLAAIPKSPETLNPFAGYEDEETGEWVNTGKEANRDRQET
VLYHMYNNGAISYDQYKEALDEKLIFTDSEEYKKEHPEASADDMMDEQKATSWVVDTALR
EYAAVLMDEYGIDEEEAIKRINSGGYQIYTTVDLDMQKYVEEKYLDLSNLMDPDSNYSWD
ENDEKIYPQSSFMAMNYKGEIQCVVGGIGEKTESLAFNRATMAKRQPGSCMKPVSTYGLA
LFSDHIHWGSMYKDSPIKLDDGKEWPQNYDYIWTRSSIPIYDALRRSRNTVPAQLCKELT
PQSVFNFSTQNLGMDLVDITEDGASDIAYAPLTIGALTYGVSIENLVNAFMPYGNGGTYY
DAHIVSRVEKGDGSLVYENDGNPHEAVDKETAYVMNKLLQEVIKSGTGTAAQLSNKTVAG
KTGTSEDWNDLCFVGMTEDFVSGVWIGYDTKTELNTSLSSAQVWYNIIGEYADSIESDNH
YPECDDVISAPMCTSTGMIAGDGCPKGITGYWKSTNAPYCSNHYSSAPSKDDEDESSEDE
SSSEAESSSKPDESSVEIVDSDSSSESAPESSPESSNAE

Enzyme Prediction     

No EC number prediction in MGYG000001756_00302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	181	366	7.5e-58	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	3.29e-145	122	769	15	594	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.86e-144	187	764	1	521	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	1.42e-100	121	818	6	764	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	7.28e-64	185	366	10	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	1.42e-61	167	747	39	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL16716.1	3.72e-273	85	829	40	800
CCO04758.1	8.19e-170	111	824	21	740
ADU22273.1	1.32e-164	111	820	19	737
CBK97274.1	3.28e-136	101	818	27	751
BCI59848.1	3.64e-136	97	838	20	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JE5_A	8.07e-52	146	832	23	707	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
7U4H_A	4.53e-51	158	818	15	807	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	7.12e-48	167	833	23	788	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3ZG8_B	1.03e-47	272	763	2	449	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3DWK_A	1.64e-47	167	748	10	557	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7GHV1	3.77e-79	165	771	57	643	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	1.04e-78	165	771	57	643	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.04e-78	165	771	57	643	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
Q891X1	1.06e-74	159	806	55	692	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
Q8XJ01	1.23e-74	126	788	32	678	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
122	144