CAZyme Information: MGYG000001756_01402

Basic Information

• Species: UBA1394 sp900538575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1394; UBA1394 sp900538575
• CAZyme ID: MGYG000001756_01402
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		42920.03	4.036

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001756	2438245	MAG	Iceland	Europe

• Gene Location: Start: 56511; End: 57680 Strand: -

Full Sequence      

MNYRKKSIIAVLSSMAMAFLCIFHVSSVETEAAVRVMPLGDSITDGFSTVGGYREPLANK
LEQNGLSGKIDFVGPNWGGNCYDPQHAGYSGYSIDNIPQENSISGARTGLSSFIDWLMET
YPADVVMLQIGTNDILSYYDLENIGTRLEGLVDSVLKYIPEDGMLYLATIPCMDANNTLY
INPYYFTPDSMDECVDKYNEEIKRIAADKQSQGKNIRLADINGVLTKEDLYDGVHPTADG
YKKMSEYWYDTLNQYLNGEDTEPTLPTEPTDQTEPVTTAPPVTSVTTFTSVTVVTEQTVT
TTIETTAIPESTTAPQTVTQPNVTTSYAYKKGDVDCDGQINTADVEVLSRILVSDIKLTD
HSGYTADMNNDGVINVFDMILLRRIILDN

Enzyme Prediction     

EC	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	34	252	8.5e-49	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01833	XynB_like	2.73e-42	34	252	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam13472	Lipase_GDSL_2	2.78e-18	39	243	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
pfam00657	Lipase_GDSL	2.91e-13	36	248	1	224	GDSL-like Lipase/Acylhydrolase.
cd14256	Dockerin_I	3.81e-13	331	387	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd00229	SGNH_hydrolase	1.13e-12	39	250	4	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV68498.1	5.32e-41	31	252	135	326
CAB55348.1	6.39e-38	29	267	39	279
AEY65113.1	1.99e-36	36	256	119	309
AVT35642.1	6.12e-35	28	252	30	227
BCJ76402.1	6.61e-35	25	267	28	243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	9.35e-21	34	249	6	192	ChainA, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RLB8	1.28e-38	29	267	39	279	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1
P15329	1.16e-08	94	264	1	151	Putative endoglucanase X (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999099	0.000179	0.000163	0.000138	0.000126

TMHMM  Annotations     

start	end
7	28