CAZyme Information: MGYG000001756_02069

Basic Information

• Species: UBA1394 sp900538575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1394; UBA1394 sp900538575
• CAZyme ID: MGYG000001756_02069
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786	MGYG000001756_18|CGC1	86192.48	4.063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001756	2438245	MAG	Iceland	Europe

• Gene Location: Start: 26493; End: 28853 Strand: -

Full Sequence      

MKLLKKALSAFAALAMCTAFFVNSAAPADIITAAGTVRDMTSQEVVSDMGLGWNLGNSFD
SYYEGQTMSPSAVETAWGNPTVTKELIQAIKNEGFKTIRIPVTWMNCIDSSNNINEDYMK
RVQEVVDYCINEGLYVILNVHHDGGSEGGWLRNAQNDYTNVSAKYQKIWEQIASNFADYS
DYLIFESMNEVGFNTSGNPTSENYKTLNSLNQLFVNTIRNSGSNNEKRHLLIAGYFTDTN
MTCDNRFEVPNDPAGRCIVSIHYYSPSAFCVAEPSSTWGYSKTWGTADEQEALEADLDLL
KTRFVNAGIPVIIGEYGVLTESENGKDKASIVTYLKSVAEGALQRGICPILWDSGNGGDM
KFINRTSKTWNISELEAVYADLAGKYSTGVTTPAVTTPDVEENSQKVALKEDEKGNLYVD
LTPYVGRLITGVGFTVEGDTYNGNGGVLLGFNVYSDATSWGGVYKGIQAPFLGQNNGQVT
KYTFDAENEESVDPKEIMYDGQTMTFSINWTYPGTYKDKLSLGGEVILYFDGAEQITTTT
TNPLETKFEERVTAVVDKEVNEEEGIDRPTMRIDISPYKGNKLVGVKFNMTGTHGDGNGA
LSYNLVDETAESGTKWAYTAFDFKSANDDIYVSLASDVTENLSYDFLSFNIWYEKDGKTS
ADYSFNPDVTLYFEDEVVIQTTPAATTTTGGDTTTTVTTTADVPPSDETIDPELVTKYGD
VNCDESVNIADVIAINMYLLDNKSNPLTDVGIANSDVVRDGEINTSDSLTLMNYVAMVVD
ESKLGA

Enzyme Prediction     

No EC number prediction in MGYG000001756_02069.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	74	355	2.1e-100	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.61e-51	74	358	16	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.67e-25	21	356	25	361	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14256	Dockerin_I	6.23e-11	718	776	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	5.56e-07	719	775	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14253	Dockerin	7.35e-04	719	776	1	56	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPB75695.1	1.21e-95	1	540	1	538
CBL16523.1	1.93e-95	1	452	1	429
CBK96026.1	2.21e-95	34	385	92	443
CBL17363.1	1.02e-94	33	359	27	355
CBL35063.1	8.81e-94	34	385	137	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XRK_A	9.34e-83	41	383	23	371	GH5-4broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate],6XRK_B GH5-4 broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate]
2JEP_A	5.67e-77	42	369	35	380	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
6MQ4_A	1.92e-70	37	375	7	341	ChainA, cellulase [Acetivibrio cellulolyticus]
6Q1I_A	1.13e-69	41	376	13	346	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]
6XSU_A	2.14e-65	39	370	10	338	GH5-4broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens],6XSU_B GH5-4 broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	5.35e-73	5	369	7	385	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P54937	6.02e-68	41	376	38	371	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P28621	1.16e-64	32	388	32	379	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P28623	3.99e-58	32	388	33	377	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P17901	2.01e-56	46	375	51	392	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999049	0.000193	0.000169	0.000160	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001756_02069.