CAZyme Information: MGYG000001757_00456

Basic Information

• Species: Ruminococcus sp900540005
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900540005
• CAZyme ID: MGYG000001757_00456
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000001757_7|CGC1	42674.67	4.7857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001757	2373085	MAG	Sweden	Europe

• Gene Location: Start: 25203; End: 26339 Strand: -

Full Sequence      

MTTIKQHEAAVSSYIENMILPSEPLMPLWNRENFIYSKPAKWNYIDACVIRAILMLYSLN
GDKRLSDYAVRFTNAYISEDGTIPTMRAEDFNLDSVNGGKNLLFLYRETGLERFRLAYEK
LVTEQLSDQPRLMCGNFFHKAIYPDQIWLDGAYMALPFMAEYSIISGKTEFADDAVKQLE
NIRDLMRDKNTGLYYHGYDESRKQKWADQKTGLSPQFWLRSIGWLCAGLTDICGILPSDS
AGYSFCTDMLAELLEALAMQTAEGGMLLQLPARHDLGENYPETSGTLLFAYSALRSARLG
ITGSAIKHAGEKAFSRVTEDFLAFDDPLPVMRNICLTAGLGGSPYRDGSAEYYLSERIAE
NDAKGIAPYIMTYTEIMR

Enzyme Prediction     

No EC number prediction in MGYG000001757_00456.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	38	378	7.4e-85	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.68e-69	42	378	34	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.02e-61	40	378	25	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35233.1	7.36e-111	11	378	10	378
QTE68952.1	5.75e-103	14	378	19	382
QEN04316.1	7.20e-100	11	375	2	366
AXB29657.1	1.45e-97	7	377	3	378
ATP00557.1	1.45e-97	11	377	10	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.16e-69	42	375	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.95e-49	41	376	38	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.32e-49	41	376	28	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	3.19e-07	102	319	118	330	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.07e-48	41	376	38	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.90e-45	154	375	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.90e-45	154	375	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001757_00456.