CAZyme Information: MGYG000001757_00965

Basic Information

• Species: Ruminococcus sp900540005
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900540005
• CAZyme ID: MGYG000001757_00965
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684	MGYG000001757_19|CGC1	75982.37	3.9942

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001757	2373085	MAG	Sweden	Europe

• Gene Location: Start: 23823; End: 25877 Strand: -

Full Sequence      

MKKAISLAAAAAIALGQAASTGLFTATAADSTEFPYKIEGEDLEGATLWTSIYENKIPNY
SGEGFTYLTGGDISFTIDVPADGMYSITVRGAQILDKGGRYQTVAVNGSEYHTTVPYADE
WTDFDFGMVRLNKGENTISFTNKYGYMAIDYVTVSEAEFPDLSIATDEACDPDATPEAKA
LLKYLKSVYGKNIISGQQQIYGGGNSVSTSIRYDSNSNKCVDSDGTEYVIDEESWDTDEQ
GNKFPWHCTGPDGQVYTYSTQNRNYTYNDYNNDINLIKEFTGKYPAIQGFDFGSYCPCYA
WDDGVTERMIEWTNDKNGICTASWHINVPTQMSDYTLGEPLDFSKTTYSNKTDFVTANCM
VEGTVEYEYFNLCVENLANELLQLQDAGVPVIFRPFHEAEGNPSTTSDPTDGSGAWFWWS
KEGTKVYKQLWNRLQDKLQDEYGLHNLIYEENLYAWSDSSAEWYVGDDRTDLVAYDKYNT
QYNRHDGKTSGPNLDAETGIFYKLNGYVNGSKMVAMAENDSIPSMSNMLVEHAYWLYFCP
WYDSASALFVSGENYQDHDEMKALYNSDFCITLDELPADLFNHGDQPTTTTTTTSGTTTT
SSQPSDILYGDANCDDKIDLSDAVMILQALANKDKYGLEGTDPTHITEQGMANADCNLSR
DGVTTADALAVQKSVIGLITLPIE

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	171	575	1.2e-77	0.9933993399339934
CBM35	44	154	5.6e-20	0.9663865546218487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	9.25e-32	171	575	2	311	Glycosyl hydrolase family 26.
cd04086	CBM35_mannanase-like	8.76e-23	37	155	2	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
pfam16990	CBM_35	2.10e-09	44	154	5	117	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.
cd14256	Dockerin_I	3.96e-08	609	673	1	54	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd04082	CBM35_pectate_lyase-like	4.04e-07	54	154	16	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIN54096.1	7.22e-196	24	577	16	501
ADU21037.1	2.06e-185	2	584	6	528
APO46210.1	7.67e-145	22	577	20	508
QZN74638.1	4.24e-144	22	577	20	508
AZK49093.1	1.12e-143	22	582	20	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	2.72e-47	35	586	12	455	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6D2X_A	3.45e-37	277	576	46	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	5.46e-35	277	576	137	425	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
6HF2_A	2.93e-28	254	583	56	363	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6HPF_A	9.99e-27	277	576	44	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	4.04e-49	36	576	44	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55297	1.36e-40	36	578	24	463	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	5.87e-38	36	578	23	461	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55296	6.53e-38	36	578	24	462	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P49425	4.29e-37	37	577	18	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000337	0.998915	0.000179	0.000219	0.000182	0.000160

TMHMM  Annotations     

start	end
7	29