CAZyme Information: MGYG000001757_01622

Basic Information

• Species: Ruminococcus sp900540005
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900540005
• CAZyme ID: MGYG000001757_01622
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
895		95390.19	4.3717

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001757	2373085	MAG	Sweden	Europe

• Gene Location: Start: 16583; End: 19270 Strand: -

Full Sequence      

MNKDLKRLSALLTGLVTVFSTVGGYTPSEKRSAANSVSAASGNIIAFPGAVGGGKFATGG
RGGEVYHVTNLNDSGTGSLRDAVSKSNRIVVFDVSGTIELKSNIICQSNITVAGQTAPGG
SGVTLKNYKFGMSGDNIIVRYVSSRPGPYASTSSGNDAWGGAKGSNSIIDHCSMGWTTDE
QWGLYSNNENYTVQYSVLGPADSWGGHKKGLHGFGIMMGKGNLTFDHNLIIHNVSRNFRG
KVVGTATADFTNNIIYDWGYQTAYGTIGHLNYVNNYLKAGKSTTGGYHWMYVDSGTSPQN
FKVYCSGNKMINKDGSTHAITNDNWSGVTLKTAIGITKDDLYSASPFATNINGENVSTAT
TCENADAAYDHVIDFAGNGISSDKRTAIDQQCAYETRTGTGSCSGTAEYDSTKTDLDKYS
IQCGVTYEYPAAVLKKEIVDNDNDGMDDNWELARGLDPNDPTDINGDYCGKGYANIEYYI
NDLTVDSFPEGVVELSPETAVEPISAFETIEAESFSLQEGVRTEDLSAVGQNIGFIENGD
WVMYRNVDFADGAKTFNAKLSGNAANIEIYTDSLDGTPAAKIAFKGTGSFGSYQDCTFNI
PSITGTHDLYLKFTGGDGYLLNMDSFVFGKETLSLNGKLFINVSVSDTAIPSSWDIGSNA
QVGSAIFGDRTFTISSINPALSGAEILMTACDAKGTTGDTAVFTAGQDIDLYVCLDSRVS
ETPAWLANYEKMCSKTENFDASSDIIFTTSNSLTFIPYKLSLKSGDKVTLGSNGQSYQCV
NFTVLALPAETTTTTTTTTTTTTTTTTSTTPPTTETVINYGDSNEDGKVDISDAVLVLQA
IANSDKYGVNGFEPSHITEQGFINADCNKSRDGVTTADALSIQKYVVELITLPVE

Enzyme Prediction     

No EC number prediction in MGYG000001757_01622.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	95	276	2.2e-53	0.9890710382513661
CBM6	508	630	1.3e-28	0.8913043478260869

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04084	CBM6_xylanase-like	8.84e-38	509	628	2	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
pfam03422	CBM_6	1.21e-28	511	630	1	125	Carbohydrate binding module (family 6).
smart00606	CBD_IV	5.58e-25	503	628	1	129	Cellulose Binding Domain Type IV.
cd04079	CBM6_agarase-like	1.80e-09	509	630	5	134	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.
cd04080	CBM6_cellulase-like	8.54e-09	509	628	4	143	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU22445.1	8.39e-289	1	786	1	728
CBL17517.1	1.52e-243	1	845	1	821
AUO19292.1	1.59e-200	11	791	14	650
BAV13046.1	2.91e-194	45	501	49	514
ADL50763.1	2.91e-194	45	501	49	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V4V_A	5.76e-29	505	630	2	129	CrystalStructure of a Family 6 Carbohydrate-Binding Module from Clostridium cellulolyticum in complex with xylose [Ruminiclostridium cellulolyticum]
5M2S_B	4.84e-19	820	890	28	98	R.flavefaciens' third ScaB cohesin in complex with a group 1 dockerin [Ruminococcus flavefaciens FD-1]
1UY1_A	4.69e-17	496	632	8	145	Bindingsub-site dissection of a family 6 carbohydrate-binding module by X-ray crystallography and isothermal titration calorimetry [Thermoclostridium stercorarium],1UY2_A Binding sub-site dissection of a family 6 carbohydrate-binding module by X-ray crystallography and isothermal titration calorimetry [Thermoclostridium stercorarium],1UY3_A Binding sub-site dissection of a family 6 carbohydrate-binding module by X-ray crystallography and isothermal titration calorimetry [Thermoclostridium stercorarium],1UY4_A Binding sub-site dissection of a family 6 carbohydrate-binding module by X-ray crystallography and isothermal titration calorimetry [Thermoclostridium stercorarium]
1GMM_A	2.98e-16	505	628	2	126	ChainA, CBM6 [Acetivibrio thermocellus],1UXX_X Chain X, Xylanase U [Acetivibrio thermocellus]
1W9S_A	3.78e-16	507	628	12	138	ChainA, Bh0236 Protein [Halalkalibacterium halodurans],1W9S_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9W_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	3.70e-45	44	488	20	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	4.31e-44	44	488	20	418	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
B0XMA2	8.13e-44	44	488	21	419	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
A1DPF0	2.04e-43	44	488	21	419	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q4WL88	2.04e-43	44	488	21	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.021466	0.460123	0.515582	0.001828	0.000570	0.000404

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001757_01622.