CAZyme Information: MGYG000001758_00363

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A
• CAZyme ID: MGYG000001758_00363
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38687	4.7636

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001758	2240992	MAG	Sweden	Europe

• Gene Location: Start: 23399; End: 24430 Strand: +

Full Sequence      

MLKNYKIREISYLRVLGRTNGSLEPVTLFWTASGIEMNIKATEAWVTVRSDYELFEPWAD
VIVDGAMSQRLMVNKGEQKICLFRNMEGDKIRNVKLLRDTPAFPTDEKTLFQILGVQTDG
EFCPLEEPKMRLEVIGDSITSGEGGSGAGGEMTWNSFCFNCVDNYAYMAAKELDAIYHCV
SQSGWGVFCSWEGDEKQAIPPYYEQVCGLLNGERNKELGAFEKWDFQKFQPDVIVVNLGT
NDGSGTKDMEKVGKAVEDFLKKLRDYNPESYILWCYGMLGNGIQPTLENAIQNYKVKSGD
ERVKFVKLPDTLEGEFGSRQHPGQKSHEKTAKVLVEEIRAIVG

Enzyme Prediction     

No EC number prediction in MGYG000001758_00363.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	131	338	8.4e-57	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	2.80e-21	131	339	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam13472	Lipase_GDSL_2	1.56e-05	225	294	56	125	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
pfam17996	CE2_N	1.85e-05	15	100	1	84	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd01833	XynB_like	1.65e-04	227	274	37	84	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd01827	sialate_O-acetylesterase_like1	2.39e-04	227	338	64	187	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ84870.1	2.51e-115	1	342	2	369
QEH70333.1	5.05e-115	1	342	2	369
ABX41518.1	1.53e-112	2	342	19	385
ANY69049.1	3.98e-111	2	342	7	373
APO43020.1	4.58e-109	2	343	7	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U37_A	4.80e-94	13	343	49	405	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
4DEV_A	1.54e-92	13	343	49	405	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
2WAO_A	4.90e-26	30	343	29	332	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	1.29e-25	30	343	29	332	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	5.56e-22	12	342	19	337	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	2.67e-24	30	343	510	813	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	3.47e-21	12	342	38	356	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001758_00363.