CAZyme Information: MGYG000001760_00198

Basic Information

• Species: UBA1417 sp900549945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1417; UBA1417 sp900549945
• CAZyme ID: MGYG000001760_00198
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531		58637.44	6.1052

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001760	2552458	MAG	Finland	Europe

• Gene Location: Start: 213389; End: 214984 Strand: -

Full Sequence      

MRILILTCATGGGHLRAAAALESYIRETTGHEVIQMDFLKSIGKLLDKTICDGYLFMAKK
TPALFGRLYKSANRDNTFADFVPRTSELLAYQLFPHIDELQPDVIISTHPFATEMVSSLK
EEKKITCPLICIMTDYGVHKAWIAPYVDAYVVACEDMVDDLVRLGIPRQSVHPYGIPVHD
VFFDKGDQPKLLREMGLDTDVPTVLFMAGSMGVSNIVQLYSELCASPLDLQIIIITGNNE
KLYNLFAEQIPTSPKKTKLVQFTKEVERYMHAADLIVTKPGGLTVSEALACNLPLAVFDA
IPGQEEDNANFLQTHDMGVRITKDNFAAVISSLIEHKERLRRMRESCRKFDKSRANENIV
ALAARLAKEFAAFNPEVSFASRKGRFSLRAAAVIFDEKGRVLLSTGSGMRQTCLPGGNVT
VNETAEDALARTLGEALAVEVSAGRPLWICQSFFTGGARNERTHELCTCFAVDAAQTNLS
ARGDRFPGAEPGTHFEWVPLDALEQAGLEPAFLRTALKNLPQTVEWVTAQS

Enzyme Prediction     

No EC number prediction in MGYG000001760_00198.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	203	353	1.7e-31	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	5.31e-93	3	362	1	358	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	4.43e-54	2	360	6	362	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	1.05e-51	2	369	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13608	PRK13608	1.00e-48	2	346	7	348	diacylglycerol glucosyltransferase; Provisional
PLN02605	PLN02605	3.70e-39	3	360	1	372	monogalactosyldiacylglycerol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB39450.1	4.37e-158	1	366	1	368
QQR28739.1	4.37e-158	1	366	1	368
ANU53873.1	4.37e-158	1	366	1	368
QEY34929.1	1.44e-146	1	362	1	364
CAB1254006.1	9.74e-146	1	369	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	2.50e-22	2	318	7	333	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]
2PQV_A	1.89e-07	386	519	18	142	Crystalstructure of MutT/nudix family protein from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],2PQV_B Crystal structure of MutT/nudix family protein from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3S2U_A	1.28e-06	204	368	183	356	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CPR3	1.11e-39	2	343	7	345	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=ugtP PE=3 SV=1
Q5HQE7	1.46e-38	2	343	7	345	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=ugtP PE=3 SV=1
B9DQ98	1.01e-37	2	345	7	347	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus carnosus (strain TM300) OX=396513 GN=ugtP PE=3 SV=1
Q49WE6	3.64e-37	2	346	7	348	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=ugtP PE=3 SV=1
Q4L524	1.80e-36	2	343	7	345	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001760_00198.