CAZyme Information: MGYG000001760_00284

Basic Information

• Species: UBA1417 sp900549945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1417; UBA1417 sp900549945
• CAZyme ID: MGYG000001760_00284
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000001760_2|CGC2	40127.24	5.4509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001760	2552458	MAG	Finland	Europe

• Gene Location: Start: 53407; End: 54498 Strand: +

Full Sequence      

MKRWKISEVPHLVHGRTNGETDPLTLFWTASGLEFNVRAAELWVELHADWSAYEPWFSFA
VNGEFLSRRMAERGTHRVCVFHGMNPETVKNVRIVKDTQAMSGDPESLLQICALETDGGF
EPVKPRALKLEFIGDSITSGEGDIGAKAEEDWVPMFFSAENNYAVMTARALDADVRVLSQ
SGWGVGCGWDNNPRNAIPPVYEAVCGLLSGERNAALGAHRPHDFAAWQPDYIFINLGTND
CGAFSQPAWCDAETGECFQNRRAADGSPCAADVERLQEKVKAFLRTLRRCNPRARLVWIY
GMLGLELAPALEAAVAAYRAESGDSRAVFLPLTDDIENRGCRNHPGVGAHRTAAAELTAY
LRR

Enzyme Prediction     

No EC number prediction in MGYG000001760_00284.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	129	361	9.9e-55	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	5.48e-27	129	362	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam13472	Lipase_GDSL_2	9.07e-08	132	321	1	128	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01834	SGNH_hydrolase_like_2	6.04e-07	129	300	3	111	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd00229	SGNH_hydrolase	1.49e-05	132	360	3	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam00657	Lipase_GDSL	1.63e-04	130	302	1	135	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ84870.1	2.22e-141	1	361	3	365
QEH70333.1	2.22e-141	1	361	3	365
QSF44991.1	1.51e-140	1	361	7	369
AGA56307.1	2.35e-139	1	362	22	385
AOK89582.1	2.85e-138	1	362	7	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U37_A	1.70e-105	15	362	53	401	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
4DEV_A	5.49e-104	15	362	53	401	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
2WAO_A	7.50e-20	28	362	29	328	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	1.90e-19	28	362	29	328	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	1.25e-13	10	363	18	335	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	1.79e-18	28	362	510	809	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	7.32e-13	10	363	37	354	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001760_00284.