CAZyme Information: MGYG000001760_00720

Basic Information

• Species: UBA1417 sp900549945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1417; UBA1417 sp900549945
• CAZyme ID: MGYG000001760_00720
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	MGYG000001760_4|CGC1	32236.46	4.5593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001760	2552458	MAG	Finland	Europe

• Gene Location: Start: 116355; End: 117224 Strand: +

Full Sequence      

MYGVVNLKRWLRVTAAAVLAVGVLGVFGALLRVFAADSGVQLPVVMYHAVIDDSGRLGQY
VISPAELESDFRWLQSHGYTAVLSEDLLRYVEDGTPLPEKPVLITFDDGYYNNYRYAFPA
AKQYGMKFVLSPIGRCADLYTEEPSESQYYAHCTWEMMREMQDSGIVEIGNHTYDLHSSD
GSRLGTRRLSTESMETYREMLSEDVNLFQKKAEENLGRAPVLFAYPFGAVSEGEPEIIAS
LGFSVTLSCEEKISTVTRDPESLVYLGRFLRPSGETSEAFFSRMLGSAG

Enzyme Prediction     

No EC number prediction in MGYG000001760_00720.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	95	246	6.8e-25	0.9307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03938	deacetyl_PgaB	1.96e-44	44	285	5	261	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB. Two well-characterized systems produce polysaccharide based on N-acetyl-D-glucosamine in straight chains with beta-1,6 linkages. These are encoded by the icaADBC operon in Staphylococcus species, where the system is designated polysaccharide intercellular adhesin (PIA), and the pgaABCD operon in Gram-negative bacteria such as E. coli. Both systems include a putative polysaccharide deacetylase. The PgaB protein, described here, contains an additional domain lacking from its Gram-positive counterpart IcaB (TIGR03933). Deacetylation by this protein appears necessary to allow export through the porin PgaA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
cd10969	CE4_Ecf1_like_5s	9.63e-40	64	269	1	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10918	CE4_NodB_like_5s_6s	1.26e-36	101	263	1	149	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
PRK14582	pgaB	9.14e-35	44	275	51	299	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB.
cd10966	CE4_yadE_5s	4.48e-32	98	280	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS79569.1	6.52e-42	36	273	25	260
AFS77609.1	1.47e-41	41	248	21	234
AAM25723.1	4.72e-39	42	254	40	265
ASF40455.1	2.77e-36	32	254	200	425
CCG46444.1	2.77e-36	32	254	200	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U10_A	5.57e-22	44	270	6	249	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]
4WCJ_A	1.12e-21	38	270	33	247	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
3VUS_A	5.95e-20	45	258	11	242	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4F9D_A	4.80e-19	45	258	15	246	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]
4F9J_A	1.18e-18	45	258	15	246	Structureof Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12],4F9J_B Structure of Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75906	2.74e-18	45	258	52	283	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q8XAR3	3.69e-18	45	258	52	283	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1
P94361	2.95e-15	37	280	60	271	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q6G606	3.61e-13	54	255	69	258	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q7A349	3.61e-13	54	255	69	258	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.993152	0.006732	0.000056	0.000023	0.000012	0.000059

TMHMM  Annotations     

start	end
13	35