CAZyme Information: MGYG000001761_00381

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger
• CAZyme ID: MGYG000001761_00381
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623	MGYG000001761_21|CGC1	70247.05	6.6873

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001761	2495136	MAG	Finland	Europe

• Gene Location: Start: 11353; End: 13224 Strand: +

Full Sequence      

MKQQPNNERPADLAVQDSVGGMARRLLNPAHLKDLARRSAATLREQGAEQLWRDVSFRVG
LAFHHDDWRHRADLPLRRTLKAQRAANLQGPCVSVVVPVFNTPLRFFDQMVKSVQRQTYG
NWQLVLVDASDDAHGEVSRRAQQYAAKDNRIVYRKIENQGIAANTTAGFEVATGEYLALL
DHDDVLYPNALFECVQTIQKTGADFVYSDEIVLSADLKQLGGYHFKPDFAPDYLRGVNFI
THLAVFSRPLLDEAGAYESSEFDGAQDHDLILRLTEKAKKIEHIKQVLYIWRGHAGSTAA
GMEAKPYAIAAGERAIDAQLQRLGLPGRAMAVPYAPGAFQVRYELTGRPLISVLIPNKDH
TDDLDRCLASLYKNAGYDNFEVIVIENNSTDPATETYYQTLPQRFDRCRVVRYQGPFNFS
AINNFGAQFAQGEHLLLLNNDIEVLSGDFLRELLSYSQRPDVGAVGAKLYYPDDTIQHAG
VLMGINGSAGHSHKSYARTAVGDMYRLVTTQNYMAVTGACLMTKTSLYKAAGGLDEEKFA
VAYNDVDYCMKLWQQGLLNVYTPRAEAYHYESKSRGLDTLSENAKRYEREKANFYAKYQQ
YIDNYDPYYNPHFNNLFENFGLK

Enzyme Prediction     

No EC number prediction in MGYG000001761_00381.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	94	207	1.9e-21	0.6588235294117647
GT2	351	574	1.1e-18	0.9217391304347826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	9.87e-78	91	292	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.26e-42	353	571	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.07e-28	347	598	1	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	1.64e-22	94	298	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	7.61e-22	94	251	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22278.1	1.48e-171	93	608	98	614
QUC66692.1	1.16e-170	94	623	419	946
AXA82332.1	1.38e-165	74	608	47	593
AXB27819.1	1.88e-165	74	608	47	593
CBK99650.1	1.10e-164	74	608	47	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	2.59e-10	91	208	5	119	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	7.56e-121	90	590	365	866	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.44e-82	75	582	302	805	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
A0A0H2UR96	1.00e-12	93	297	5	220	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P71057	3.72e-11	88	297	1	217	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q4UM29	8.04e-10	81	200	4	119	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001761_00381.