CAZyme Information: MGYG000001761_02014

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger
• CAZyme ID: MGYG000001761_02014
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228		25951.2	7.0555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001761	2495136	MAG	Finland	Europe

• Gene Location: Start: 7; End: 693 Strand: +

Full Sequence      

MRYDRARVVRYKGGFNFSRINNFGRKYATGSYLLMLNNDIEVINGDWLTQMVGECIQPGV
GICGAMLYYPDDTIQHAGIITGLGGYAGHSHKYHKRGGSGYMFRLATVQDFSAVTAACLL
VRTAVFDAVHGLDENLTVAYNDVDFCLRVRDAGWRILWTPYAELYHHESKSRGSDEKDPV
KKARFDAEHDRLYAVHGRDNIIHDPYYNPALSLDYEDFRESGDLRHLK

Enzyme Prediction     

No EC number prediction in MGYG000001761_02014.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.45e-27	3	168	48	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.02e-19	17	174	69	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
TIGR03965	mycofact_glyco	1.78e-11	5	166	130	280	mycofactocin system glycosyltransferase. Members of this protein family are putative glycosyltransferases, members of pfam00535 (glycosyl transferase family 2). Members appear mostly in the Actinobacteria, where they appear to be part of a system for converting a precursor peptide (TIGR03969) into a novel redox carrier designated mycofactocin. A radical SAM enzyme, TIGR03962, is a proposed to be a key maturase for mycofactocin.
cd02526	GT2_RfbF_like	1.78e-06	120	167	157	204	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd02525	Succinoglycan_BP_ExoA	9.89e-06	22	167	74	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATL90529.1	6.12e-119	2	228	387	615
AXB27819.1	6.18e-118	2	228	387	615
CBL01588.1	8.74e-118	2	228	387	615
QIA43913.1	1.95e-117	2	228	387	615
ATP00360.1	1.95e-117	2	228	387	615

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.01e-60	5	218	683	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.53e-34	15	217	640	837	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P46370	1.10e-08	8	166	182	329	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1
P9WMY2	3.93e-07	114	175	183	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	3.93e-07	114	175	183	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997683	0.002271	0.000050	0.000005	0.000003	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001761_02014.