CAZyme Information: MGYG000001762_00234

Basic Information

• Species: Anaeroglobus geminatus
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Anaeroglobus; Anaeroglobus geminatus
• CAZyme ID: MGYG000001762_00234
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000001762_2|CGC1	43164.27	8.2846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001762	1764081	MAG	Estonia	Europe

• Gene Location: Start: 17125; End: 18288 Strand: -

Full Sequence      

MPMAKKILIMSASIGTGHTQAARAIEEYMSQNCAGYEVEQLDFISNDVLSIDNLVKETYI
KILDVFPLLYDLMYYSSQGYKKGMIVKTLFAWGLKRRMSRILEEKKPDLLVCTHPFPAGA
AALLKRRSKMNIPIVGVITDFAVHSLWVYPQIDRYFVAAPHLRDMLVGQGVAEERIFVSG
IPVRTAFTEEQWSGRKRIQTEKNVLIMGGGLGMGAIKESLMLLDKLECVDTFTVVTGHNA
DLFDDLSQLQRELRHPVRIFGYTNRIAALMAEASLLVTKPGALTCTEAAAVGVPSVFFSP
IPGQEEANAAYMQEKGCARWVKTQARLITAVSDLLRHPERLGDMSRACRFCRRDGAQIIG
RRVAELLQSQAEKTISVCRTDEPDVIS

Enzyme Prediction     

No EC number prediction in MGYG000001762_00234.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	204	350	2.9e-33	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	3.06e-80	7	367	1	359	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	1.38e-73	1	371	1	373	diacylglycerol glucosyltransferase; Provisional
PRK13608	PRK13608	5.63e-55	5	345	6	346	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	3.19e-52	6	373	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam06925	MGDG_synth	6.03e-33	18	183	1	169	Monogalactosyldiacylglycerol (MGDG) synthase. This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL20124.1	1.04e-185	5	381	4	380
AVO75296.1	2.89e-184	5	370	4	369
CCC74010.1	2.89e-184	5	370	4	369
ALG42544.1	2.89e-184	5	370	4	369
AVO28006.1	2.89e-184	5	370	4	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	2.03e-26	5	333	6	348	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]
7D1I_A	4.19e-12	5	319	10	314	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	4.25e-07	82	335	72	319	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	5.54e-06	85	345	77	332	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q81IA1	1.07e-57	6	347	6	348	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=ugtP PE=3 SV=1
B7H9Q4	1.07e-57	6	347	6	348	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain B4264) OX=405532 GN=ugtP PE=3 SV=1
B7IW03	4.16e-57	6	347	6	348	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain G9842) OX=405531 GN=ugtP PE=3 SV=1
A9VSQ8	8.21e-57	6	347	6	348	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus mycoides (strain KBAB4) OX=315730 GN=ugtP PE=3 SV=1
B7HU46	1.15e-56	6	347	6	348	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain AH187) OX=405534 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001762_00234.