CAZyme Information: MGYG000001762_00646

Basic Information

• Species: Anaeroglobus geminatus
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Anaeroglobus; Anaeroglobus geminatus
• CAZyme ID: MGYG000001762_00646
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
190		22047.18	5.0807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001762	1764081	MAG	Estonia	Europe

• Gene Location: Start: 66982; End: 67554 Strand: -

Full Sequence      

MRRKNRTDTTIIAVLAVLLCIFYFSSWKQTVMRKFVYPLEYDYMVRQYAHANGVRPSLVA
AVVLAESKFNQEAASRRGASGLMQIMPETGEWIAEEMGLPGFSADKLSDVSMNLRMGTWY
LAYLFREYDGNTILALSAYNAGRGQVDEWIKEYGWDKNFSEIEQIPFSETREYVKVVMQN
EEQYKALYDF

Enzyme Prediction     

No EC number prediction in MGYG000001762_00646.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	54	184	6.3e-30	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.78e-75	38	182	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.45e-59	37	187	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.95e-37	56	180	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.46e-34	37	188	135	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK11619	PRK11619	9.18e-32	37	188	475	624	lytic murein transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL22000.1	4.67e-92	1	190	1	191
AXB81730.1	2.99e-88	1	190	1	191
ALG43012.1	5.73e-86	2	190	3	191
AVO73570.1	1.15e-85	2	190	3	191
AVO26251.1	1.15e-85	2	190	3	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	7.86e-24	37	185	449	599	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	7.86e-24	37	185	449	599	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5MPQ_A	1.39e-23	33	188	404	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.40e-23	33	188	408	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.41e-23	33	188	414	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	4.39e-23	37	185	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	4.39e-23	37	185	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	3.29e-21	37	185	476	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	8.05e-17	42	177	61	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	5.27e-15	37	180	1418	1540	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.971552	0.006059	0.015657	0.000027	0.000020	0.006711

TMHMM  Annotations     

start	end
10	27