CAZyme Information: MGYG000001765_00191

Basic Information

• Species: CAG-448 sp000433415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-448; CAG-448 sp000433415
• CAZyme ID: MGYG000001765_00191
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850		95731.89	4.867

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001765	2169338	MAG	Denmark	Europe

• Gene Location: Start: 15769; End: 18321 Strand: +

Full Sequence      

MLKIVGLTINHEVLPCTTEVDCPVFGWKLESDRQGIRQSAYRIRIDHADGVFADTGRVTG
AQTAEVCMPDLHLSSRTDYIVTVTVWDEKEECAVVSMPFSTGIGADEWAPAKWIRAAEDI
VGWAPYLRKKFTLDAPDVKKATLYVSGLGCGEYYLNGQRIGDAYIDPPQTNYEREVLYRC
FDVTSMLKTQNALTALLGEGFYAQSRVWSVEGFRYGPVCLIARLEILFANGTQQTVVTDE
SWKYKYSPITSNNLYAGETYDCRLETPDFSDADGSDAGWCACEADTVPKGALKGCHMPPV
RIIRKVPTVSIRNMSGVNDGAWLFDFGENFAGMVEIHIPHSPRGAQYVLRFAETINDRGQ
LDFRSIGSFATQCIQQDIYIARGDEAGEVWHPRFTYHGFRYMELTGYHDLRKYGQDPELT
FALGYALSTDLRQAGHFSCDYAPLDRFQALALRTFRSNYHGLPEDCPAREKCGWLGDAQI
VCDFGIMNYDMQTAYLQYLSDLRTQTEVYGTWTMIAPGKRGCGEATPLWGCAQVLIPERL
YRYYGNTQVIRDNWDLMEGWVEHERLASENWLRTDGLGDWDPAGGNGHTRRMPVAHSSSM
MFYEICTVMCRLASELPDQQKKAAYYADMAEKIKESIISHYYDKDAHSYGYWGSDGVALT
LGLYPDGERQLLLRALVETIRAEDFEMHTGIYANKYLVPLLCREGYGDEAMEFLFGLRHP
SFGTMMEDGATSVWEAPDMQGIDMDRTHGVASYNHPMHTGFAYAFYTELAGISPNTPGFA
RFRIAPCRLERITALQASYESPFGQIAVSYQRSDNGEYRYTLTVPAGSVCEFTKIGESDP
IVLQSGTYSF

Enzyme Prediction     

No EC number prediction in MGYG000001765_00191.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	317	831	3.3e-121	0.9861111111111112
CBM67	111	283	1.7e-28	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.41e-59	432	766	1	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.83e-49	137	304	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.14e-23	317	409	3	89	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.79e-12	771	831	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF92025.1	6.47e-147	104	829	8	729
QGY42608.1	3.36e-143	2	846	26	869
QGA24281.1	2.35e-142	20	828	50	881
ANH81210.1	7.76e-130	111	825	39	773
SCM59076.1	2.43e-127	20	828	52	894

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.06e-104	23	828	51	892	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	5.01e-87	105	831	284	991	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.02e-60	23	810	23	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	3.15e-115	9	825	37	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.30e-86	105	831	284	991	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	7.27e-71	23	811	55	856	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.23e-70	23	832	51	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001765_00191.