CAZyme Information: MGYG000001765_00435

Basic Information

• Species: CAG-448 sp000433415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-448; CAG-448 sp000433415
• CAZyme ID: MGYG000001765_00435
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680		76387.44	5.728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001765	2169338	MAG	Denmark	Europe

• Gene Location: Start: 24234; End: 26276 Strand: +

Full Sequence      

MHPFYRAKLITDRAFAARAPQNVFHREHEPFPGEPETELDCHLLFRRTFSLPDGAHRYTL
YISADDYYKLYVNGTFVTQGPAPGYPQHYYYNTVDLTPRLHPGKNVIAVHTYYQGLCNRV
WVSGDHRQGLICALYDRDTPVLCSDSAFLVRRHSGYTQTGRYGYNTQFAESYDARVPEHG
FFAPDFDDSDWEHALPAVDDHTYFPQPTAQLTLYPLDPVICERHGDRLFLDFGQEIVGYP
RLCAQGNAGDTVMLYAGEELCADGSVRWQMRCGCNYRECFTLSGGRDVLPIYDYKAFRYM
EIEAPSHVRLTDVGATVRHYPFTCIRHFSLPAGLPPTCDAEVLERIFTLCVNTIRYGVQE
TFMDCPSREKGQYFGDGVYTALSHMLLTGDTAMTGKMIENAFSSAFIHPCLMAGGPQAFA
QEIAEYPLMTLVLIPLRYTFDRDRNALAAGFRAACRLIDAYARTYGRADGLIAVHDKWNV
VDWPPEARDGYDCPLPDTGTPVAHNVINGYWLCALSAVNRAARLLGVSEPYDYCAAADAY
MRTFYRPASGLFADTADSAHTAIGSNAFALLLDLPLPDGNGAILELIRQKRLNASNLFVS
PLILFGLFRAGQTDLLYDLLCDRNYWLRMLAEGATTTFEAFGKDRKWNTSLCHTMFALPV
AFLCGWSPDDYLGACPASES

Enzyme Prediction     

No EC number prediction in MGYG000001765_00435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	224	664	1.8e-66	0.8571428571428571
CBM67	40	194	8.8e-38	0.8579545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.39e-19	337	663	7	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.24e-15	57	220	5	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.13e-09	230	319	10	100	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam02837	Glyco_hydro_2_N	0.002	45	109	69	131	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43798.1	1.75e-165	5	672	75	741
BBH20286.1	1.36e-152	5	663	5	667
QCT01521.1	2.19e-151	1	673	1	672
AEN95938.1	1.85e-150	10	660	30	680
QBE96895.1	6.23e-147	10	663	9	657

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	5.04e-15	46	639	306	895	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	9.49e-14	37	370	123	466	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	8.03e-12	44	381	178	514	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
2OKX_A	1.84e-11	35	194	19	176	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.74e-14	46	639	306	895	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.91e-11	46	649	174	783	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001765_00435.