CAZyme Information: MGYG000001765_00766

Basic Information

• Species: CAG-448 sp000433415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-448; CAG-448 sp000433415
• CAZyme ID: MGYG000001765_00766
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695	MGYG000001765_19|CGC1	78519.74	4.8401

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001765	2169338	MAG	Denmark	Europe

• Gene Location: Start: 21103; End: 23190 Strand: -

Full Sequence      

MKQFEKSVWIWREGQAGKDEFVDFVDTFSRDGDAPVTLHIAADSNYSVWLNGELAAFGQY
ADYPFYKVYDTVDLTHLCRQGQNRLAITVWYYGEGFQTYAPGEAGLIYEILSAETVLAAS
TPSVLSRRSREYIAGEQMKISPQLGFTYHYDCKGDDGFRASVADGFLPSRAVPGISRDFH
ARPNQKLKLEERLPVKICQQGLFRYPDGIGSDYNAAQQMQYAALSFRQMSALCPTAADTL
CGEAGYGIYWIADLGKENTGFLDLDIEVPEDCRIDIGYGEHLEDGRCRTDVRHFACRIEA
KKGRNTYLHTFRRFGCRYLQFFVHTTSVTIHYAGLRPTTYPFTLQPYKTGNLLRDTIYEV
CVNTLVQCMHEHYEDCPWREQALYVMDSRNQMLCGYYAFGEYEAPRAALKLISLGQRPDG
LLTICYPTGRDAPIPSFSTMYFVQMYEYIKYAGDITLAQECYPVLTSLARTFTDRLNQDG
LIPSFAGEGGYWNFYEWSDTMAGRFDEPESHMEAPLNAYLSLALQAMANICVALGKNEEA
ADYRACAAKLNRAIAAHFYQEKDGLFFSFDDRDMEKYSMLTNALCLLCGAADGIADKTVL
LRVLASNGKDNCGLSVIPNTLSMNSFRFDALLKEDREAYAQMILDEIDRDYLYMLRAGAT
SFWETIEGAGAFADAGSLCHGWSALPIYYYKTLLS

Enzyme Prediction     

No EC number prediction in MGYG000001765_00766.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	249	689	4.5e-71	0.8472222222222222
CBM67	9	112	1.1e-17	0.6022727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.11e-23	347	693	6	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	0.005	250	320	8	83	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95627.1	2.84e-167	9	693	13	707
QGQ97405.1	4.45e-141	1	694	3	714
QNK57365.1	2.06e-126	1	690	1	709
ARN56684.1	3.26e-115	6	694	22	712
AQQ71631.1	4.52e-92	2	689	4	687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.61e-39	251	689	440	871	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	9.25e-11	360	691	222	539	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001765_00766.