CAZyme Information: MGYG000001765_01328

Basic Information

• Species: CAG-448 sp000433415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-448; CAG-448 sp000433415
• CAZyme ID: MGYG000001765_01328
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654		75294.73	4.9647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001765	2169338	MAG	Denmark	Europe

• Gene Location: Start: 4333; End: 6297 Strand: -

Full Sequence      

MKTTRKDMELLARLSTFTTPERIPMRLKIGEQAIQGIPSRFVPQITKRSADTNMRMLTVS
AKTEEGLRILVEYTEYTDYPMVEWVAFITNEADTDSPILSDWHIGTCVIPGTHPVLVHGN
GDTCRPDGYTWRHDPLNAPHTVAPCGDGTPCNGAFPYLRLLFDDWGVNLACGWSGQWQAD
FAPTGNGVSVSFGQQTFRTYLKPGETVRTPRVNLMAFAGGEDRGRNLWRSFYFAHMLPRA
NGQPLDPKLVLHTWMIDGKPEFTGVTEENQIKAIDTYLEHGYQPDIWWIDAGWYPCNFNW
PTIGSWVCNPEHFPHSMKPVADHCAANNIDLLVWFEPERVLVGTEIDLEHPDFLLYYTGE
NEWLRQNRLLNLGNPRALAWITDRINKLIRENGIRIYRQDFNFPPMPYWQENTEKDRDGI
LENLHIQGYYAFWDALLDRNPGLWIDSCASGGRRNDPETMRRAVPLHYTDVGYGNHPIKQ
KQHREMFEWIPYFRAHTYNWDEPDGSYGTTNHKLDEFAFQNAMTPCVTSMVEYYDSDELY
ALGLRMEPIWRKAAELELCGDYYPLTACNADTHDWYAMQFDDPDNRSGFVQLIRNTQAPD
DSLCVSFHVEDAAATYRFDNPLSGETLQIQGKELLNGLSGTLEKRTAIILFYKY

Enzyme Prediction     

No EC number prediction in MGYG000001765_01328.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	30	466	1.9e-55	0.6177325581395349

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	6.38e-36	262	463	13	212	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	4.73e-19	289	457	77	247	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	8.72e-15	165	463	210	498	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	0.003	278	394	28	144	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBO31825.1	7.90e-109	22	651	48	681
BBO33728.1	1.01e-104	22	649	49	681
BBO33698.1	1.23e-103	22	651	50	684
QOY88337.1	2.73e-96	24	653	175	790
QGQ94285.1	1.52e-93	59	635	60	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	1.93e-17	188	456	275	538	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
6PHU_A	1.52e-14	188	461	285	552	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	6.06e-14	188	461	285	552	ChainA, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]
3MI6_A	4.21e-13	26	456	109	535	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1UB44	1.06e-16	188	456	275	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P27756	1.38e-16	36	456	109	527	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3
P16551	1.15e-14	289	462	328	497	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001765_01328.