CAZyme Information: MGYG000001767_00445

Basic Information

• Species: RC9 sp000432655
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000432655
• CAZyme ID: MGYG000001767_00445
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757		84468.83	6.3081

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001767	1796916	MAG	Denmark	Europe

• Gene Location: Start: 33058; End: 35331 Strand: +

Full Sequence      

MLNNFKISCALLASLAFATLAQAQPGRGGRPAGQMPVQVSSPVVNPDHTVTFNYRNDNAK
DVKVNAQFAGTRDMVKGENGVWSLTLGPAAPDMYPYCFVVDGIQVMDPLNPDWFPNEGFK
NSIVDIRNPQSPLVHSAQNVPHGAVDYVNYWSESIGTYGNAIVYTPPFYDKNKDKKYPVF
YLISGTTDTEEVYFKVGRVNFILDNLIAQGKAEPMIVVLPYGNPAKYFPEGTDLRGRGDM
FSNDLIGDLMPFVEKNYRTINDRDHRAIGGFSRGGNQGLSNGLRNIDKFSYLCSYSSFTT
TDLPIYDDADKLNDSLHLFWLGVGTDDFLYGSAVDYLKFLDSKGIHNVKYFTHDKFGHTW
MNAKCFLNETLPLLFRPGAKTESMQITVEPKKGEQQLTPQVMGRLFAKPVVSPEYNADGS
VTFRVNAPNASKVELECQMFSGTRPMAKDANGAWSITVKPEVPDIYPYAFVIDGTKVADA
ANMFIFPNEGFKYSLADVRGPEPGIQDMQNVPHGKVSYRYYHSDNCGGIERPMCVYTPAG
YEPEGKEKLPVLYLIHGMTDTYETWFKVGHANIILDNLIAQGLAKRMIVVMPYANPYIEM
NASGLDKPYNAMDTDLITAEILKEVIPFVESNYNVYKDADHRAIAGFSLGGRQALACGLG
NTDKFHWVAAYAPAIFGTEYESNFTNGTYNSIKDIKKNLKFLWLGTGSEDFLIQASQGLN
KYLTVNKVKHTFYNPGGGHTWMNCRDYLELTAKQLFK

Enzyme Prediction     

No EC number prediction in MGYG000001767_00445.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	530	750	1.7e-48	0.9295154185022027
CE1	152	372	1.7e-41	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.19e-33	443	741	4	281	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	5.98e-29	48	126	1	82	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd11294	E_set_Esterase_like_N	7.79e-28	419	498	1	82	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	2.66e-24	107	377	30	298	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	2.35e-15	530	741	7	232	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE48404.1	6.79e-110	4	376	2	383
QNA46490.1	1.09e-109	11	376	11	387
CCH00342.1	1.53e-109	11	377	12	387
AKD53831.1	2.94e-109	1	376	1	385
AYQ33229.1	6.59e-108	6	376	9	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	8.33e-61	28	376	11	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	3.23e-48	42	376	40	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOU_A	5.08e-47	24	376	12	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOT_A	1.06e-46	31	376	3	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6NE9_A	5.15e-39	42	376	42	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	4.43e-38	414	757	42	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	4.52e-38	73	376	359	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	1.01e-33	501	739	35	260	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	4.14e-27	42	291	395	648	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P51584	3.89e-08	163	375	845	1075	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000224	0.998999	0.000196	0.000205	0.000183	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001767_00445.