CAZyme Information: MGYG000001767_01268

Basic Information

• Species: RC9 sp000432655
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000432655
• CAZyme ID: MGYG000001767_01268
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	MGYG000001767_21|CGC1	32772.79	8.9637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001767	1796916	MAG	Denmark	Europe

• Gene Location: Start: 20869; End: 21729 Strand: -

Full Sequence      

MRILLLMVMLFVGMPAGPDKHPQAPSVPKMIVFAGDTISFDRQDIYERMDRELISFTYMH
TNSTLMLKRSKRIFAKVVPILRANGVPEDLKYLMAIESNFDPKALSSAGAAGLWQFTKST
AKEYGLEVSSEVDERYHIEKETVAACKYLLKAYDKYGDWMTVAASYNGGQNGISKRIENQ
RQRKAMDLWLVEETSRYMFRILTAKMFFEDPTSFGFYVREKDKYPVEPKPKETVSVSGPI
ENLVDFAEEHGIRYATLKGANLWLRDSKLTNKAGKTYEIVIPREDQ

Enzyme Prediction     

No EC number prediction in MGYG000001767_01268.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	82	203	2e-21	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	7.65e-60	81	206	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	2.93e-24	83	184	7	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	4.80e-22	87	261	118	292	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	5.63e-16	93	204	7	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.01e-13	77	203	10	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR42145.1	1.18e-100	24	285	48	307
QIU94901.1	1.18e-100	24	285	48	307
QUT70157.1	1.67e-100	24	285	48	307
BCA49012.1	2.09e-100	24	285	55	314
QDH54854.1	2.36e-100	24	285	48	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YT5_G	1.08e-07	83	173	44	137	ChainG, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_H Chain H, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_I Chain I, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
7EYB_I	1.08e-07	83	173	22	115	ChainI, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_B Chain B, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_D Chain D, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_F Chain F, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_G Chain G, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.02e-21	33	284	62	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.02e-21	33	284	62	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P03726	5.92e-07	83	173	22	115	Peptidoglycan transglycosylase gp16 OS=Escherichia phage T7 OX=10760 GN=16 PE=1 SV=1
O31608	1.67e-06	85	175	72	158	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005528	0.978711	0.014877	0.000293	0.000276	0.000279

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001767_01268.