CAZyme Information: MGYG000001767_01381

Basic Information

• Species: RC9 sp000432655
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000432655
• CAZyme ID: MGYG000001767_01381
• CAZy Family: GT4
• CAZyme Description: Alpha-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	MGYG000001767_24|CGC1	45546.82	6.2635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001767	1796916	MAG	Denmark	Europe

• Gene Location: Start: 26193; End: 27407 Strand: +

Full Sequence      

MDLSSLFSIEKANVGLFCDCFPPVMDGVSVCMQNYAEWMQKKVGETVVVTPNVPKADYSK
LDYKVLDYFSVPIPKRPPYVTGIAEIDPVFLAKISRIKFKIVHAHCPFTSGLAAMRIARL
QKIPLVATFHSKYRDDFARVLPEPAVKAMLKLVVGFYERADMVWVPQESVVDVIREYGYK
GKVEVMDNGSDLVADYPDKYFADARNRLGIRPEEFVMLFVGQHIWEKNPKLVIEALALLP
DVPFRMYFIGNGYAAQEMKSLVSERGLDSKVTFVGTITDREKLKDYYAVSDLFLFPSLYD
NAPLVVREAAALHTPAVMAKGSTASQIITDGADGFLVDNDPEKMAELLRKLVADPARVHR
VGIQASRSIVRSWEDCVDEVIDRYNSLLRSWGLDPIDRIETLKQ

Enzyme Prediction     

No EC number prediction in MGYG000001767_01381.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	210	357	6.3e-30	0.93125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03817	GT4_UGDG-like	7.59e-97	13	380	1	372	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03801	GT4_PimA-like	1.25e-48	13	385	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03814	GT4-like	1.53e-47	14	384	2	364	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.
COG0438	RfaB	4.82e-44	13	389	2	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03800	GT4_sucrose_synthase	1.02e-36	101	384	104	396	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM72276.1	1.35e-146	14	389	2	378
QCQ47094.1	1.35e-146	14	389	2	378
QCQ38451.1	1.35e-146	14	389	2	378
QCQ33905.1	1.35e-146	14	389	2	378
QCQ49550.1	1.35e-146	14	389	2	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6D9T_A	9.59e-13	5	354	14	355	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]
6N1X_A	1.16e-12	20	354	11	339	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
2IW1_A	6.29e-07	196	358	170	342	CrystalStructure of WaaG, a glycosyltransferase involved in lipopolysaccharide biosynthesis [Escherichia coli str. K-12 substr. W3110]
2IV7_A	8.36e-07	196	357	170	341	CrystalStructure of WaaG, a glycosyltransferase involved in lipopolysaccharide biosynthesis [Escherichia coli str. K-12 substr. W3110]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q93P60	1.03e-26	13	348	2	348	Alpha-monoglucosyldiacylglycerol synthase OS=Acholeplasma laidlawii OX=2148 GN=mgs PE=1 SV=1
Q8CWR6	2.10e-23	13	355	2	349	Alpha-monoglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0982 PE=1 SV=1
Q8S4F6	1.81e-20	10	391	102	484	Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1
D1BZ82	6.43e-20	99	384	110	407	D-inositol 3-phosphate glycosyltransferase OS=Xylanimonas cellulosilytica (strain DSM 15894 / CECT 5975 / LMG 20990 / XIL07) OX=446471 GN=mshA PE=3 SV=1
A4T324	2.20e-17	99	394	121	420	D-inositol 3-phosphate glycosyltransferase OS=Mycolicibacterium gilvum (strain PYR-GCK) OX=350054 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001767_01381.