CAZyme Information: MGYG000001767_01422

Basic Information

• Species: RC9 sp000432655
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000432655
• CAZyme ID: MGYG000001767_01422
• CAZy Family: GH67
• CAZyme Description: Extracellular xylan exo-alpha-(1->2)-glucuronosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615		69575.25	5.3839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001767	1796916	MAG	Denmark	Europe

• Gene Location: Start: 94; End: 1941 Strand: +

Full Sequence      

MEGGSSAAVRYGIYALQRAEVMGQAGPGMDVREKPYYEYRILNHWDNLDDTVERGYAGLS
MWEWTAPEIPVERIHHYGKLCASVGLNGAVLNNVNSNPLILDSEHIARISEIADILRQYG
ITTYLSIKWTSPIALSGIKSGDPLNPQVRKWWKDKAAEIYAAIPDFGGFLVKANSEGQAG
PQDYGRTHADGANMLAEALKPYGGIVMWRAFVYSPTSPDRANQAVEEFKPLDGKFADNVI
IQIKNGPIDFQPREPFSPLFGQLKKTAMMVEFQITQEYLGFSNHLVYHGTTYEECLDSDT
YRDGQGSTVAKNIKAIAGVANTGQDPNFCGYIFAQSNWYAFGRLAWNPELSAEQIADEWV
KQTFNKPEGMSEKAFEQKFLSPVKDILMTSRETAVNYSMPLGLHHIFAGSHYGPGPWERS
IRPDWSCVYYHKAGEDGIGFDRTRTGSDNVDQYNQPLADEFNSLETCPENLLLWFHHVPW
DYKMHNGNILWDELCRHYDTGISQVEGYIKTWESLKPYVSQAIFEEVSRKLDIQKNDAQW
WRDACVGYFQTFSKMPLPQDVRALNVPIDSLRTKSMLSDRYGMPTHDENNQPVLVTPKRR
PRIGTLPGQDSSIPE

Enzyme Prediction     

EC	3.2.1.139	3.2.1.131	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH67	3	559	1.2e-244	0.8385650224215246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3661	AguA2	0.0	3	556	113	674	Alpha-glucuronidase [Carbohydrate transport and metabolism].
pfam07488	Glyco_hydro_67M	0.0	22	327	4	324	Glycosyl hydrolase family 67 middle domain. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the central catalytic domain of alpha-glucuronidase.
pfam07477	Glyco_hydro_67C	1.08e-123	329	560	1	221	Glycosyl hydrolase family 67 C-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the C terminal region of alpha-glucuronidase which is mainly alpha-helical. It wraps around the catalytic domain (pfam07488), making additional interactions both with the N-terminal domain (pfam03648) of its parent monomer and also forming the majority of the dimer-surface with the equivalent C-terminal domain of the other monomer of the dimer.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ50208.1	0.0	1	595	72	667
QUT46124.1	0.0	1	595	72	667
QRQ48269.1	0.0	1	595	72	667
AYM99018.1	7.76e-256	11	561	102	656
QQY30099.1	8.95e-255	4	561	95	656

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQI_A	6.76e-205	5	558	116	672	Structureof Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQI_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQJ_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQJ_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQK_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQK_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQL_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus],1GQL_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus]
1H41_A	5.45e-204	5	558	116	672	Pseudomonascellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus],1H41_B Pseudomonas cellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus]
1MQP_A	7.49e-158	3	549	108	663	TheCrystal Structure Of Alpha-D-Glucuronidase From Bacillus Stearothermophilus T-6 [Geobacillus stearothermophilus]
1MQR_A	2.11e-157	3	549	108	663	ChainA, ALPHA-D-GLUCURONIDASE [Geobacillus stearothermophilus]
1K9D_A	4.22e-157	3	549	108	663	The1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1 [Geobacillus stearothermophilus],1L8N_A The 1.5A crystal structure of alpha-D-glucuronidase from Bacillus stearothermophilus T-1, complexed with 4-O-methyl-glucuronic acid and xylotriose [Geobacillus stearothermophilus],1MQQ_A THE CRYSTAL STRUCTURE OF ALPHA-D-GLUCURONIDASE FROM BACILLUS STEAROTHERMOPHILUS T-1 COMPLEXED WITH GLUCURONIC ACID [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3PC73	8.10e-204	5	558	140	696	Extracellular xylan exo-alpha-(1->2)-glucuronosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=gla67A PE=1 SV=1
P96105	3.49e-160	3	556	105	665	Xylan alpha-(1->2)-glucuronosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aguA PE=1 SV=2
Q09LY5	4.10e-157	3	549	108	663	Xylan alpha-(1->2)-glucuronosidase OS=Geobacillus stearothermophilus OX=1422 GN=aguA PE=1 SV=1
Q5AQZ4	2.36e-123	35	597	159	724	Alpha-glucuronidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aguA PE=1 SV=1
B8NGU1	2.73e-123	29	553	152	683	Probable alpha-glucuronidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aguA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001767_01422.