CAZyme Information: MGYG000001769_00126

Basic Information

• Species: CAG-488 sp000434915
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-488; CAG-488 sp000434915
• CAZyme ID: MGYG000001769_00126
• CAZy Family: GH35
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	MGYG000001769_1|CGC3	66977.99	4.8858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001769	2247196	MAG	Denmark	Europe

• Gene Location: Start: 127080; End: 128831 Strand: +

Full Sequence      

MAILTYKGNKFLLDGEEYTIISGAMHYFRIPREYWHDRLLKLKECGFNTVETYTCWNLHE
PCEGVFDFGGMLDLEAYIDIAEELGLNVILRPGPYICAEWEMGGLPAWLLNYKNMTIRCN
DELFISKVERYYNELLSRIVPKLSTNGGNVIMMQIENEYGSYGDDHEYMQRIADIYKKNG
VDCLLFTSDGADYSSLQGGTLPEYPCVANFGSRPEVNFKVLNDFRPDQPLMCGEYWVGWF
DHWYEEHHVRNPKEVAKLFKDMIDCGASLNFYMFHGGTNFGYMNGANYYDKYEPTITSYD
YNALLSEAGDLTPAYFEVRKIIEEKFGKLPELTVKNSEKAAYGKLELNERCSIFEAAKLL
SKPIHSASPQFMEDIGQYYGFTLYSTVVDGPRDEREIKFDAVHDRAVVFIDGEYKGFYER
TRDGKPVSFSLKKGESCRIDILCENMGRVNYGPKIMDRKGIKGVRFNLQYHFGWDMYPLP
LDNISSLRFEQKSGEVNVASFLKGTLKINDEPHDTFMRLDGFTKGVVFVNGFNIGRYFNP
AGPQKTLYVPAPMLKKGDNEIVVFETDHSDRSSVTFLDEPDLG

Enzyme Prediction     

EC	3.2.1.23	3.2.1.38	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	11	323	9.4e-120	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	2.33e-153	11	322	2	315	Glycosyl hydrolases family 35.
COG1874	GanA	6.11e-64	6	567	3	591	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
PLN03059	PLN03059	1.34e-45	1	309	27	325	beta-galactosidase; Provisional
pfam02449	Glyco_hydro_42	5.04e-12	31	165	8	149	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam13364	BetaGal_dom4_5	0.001	527	563	66	103	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK60278.1	1.52e-226	1	583	1	583
SMF87753.1	5.36e-226	1	583	1	589
QJD88406.1	1.43e-224	1	583	1	582
QAV16979.1	7.62e-224	1	583	1	586
AUS98261.1	3.42e-222	1	583	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	9.23e-201	1	583	15	594	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	8.41e-177	9	582	8	587	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
7KDV_A	4.71e-143	4	580	18	627	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	1.52e-138	1	583	8	622	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	3.06e-138	1	583	32	646	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58D55	1.63e-146	4	580	33	641	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q3UPY5	3.89e-143	4	583	47	630	Beta-galactosidase-1-like protein 2 OS=Mus musculus OX=10090 GN=Glb1l2 PE=1 SV=1
Q9TRY9	5.09e-143	4	583	35	646	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
P23780	4.30e-142	4	580	35	644	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
Q8IW92	2.45e-141	4	583	47	630	Beta-galactosidase-1-like protein 2 OS=Homo sapiens OX=9606 GN=GLB1L2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001769_00126.