CAZyme Information: MGYG000001769_00619

Basic Information

• Species: CAG-488 sp000434915
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-488; CAG-488 sp000434915
• CAZyme ID: MGYG000001769_00619
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817	MGYG000001769_3|CGC2	92875.71	4.814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001769	2247196	MAG	Denmark	Europe

• Gene Location: Start: 81805; End: 84258 Strand: +

Full Sequence      

MEKIWNNAKFIYTEFRNYFDASKNPWGRRIPYVNQHCEIVDNNGLPMFWSDFDIVSGEKT
ELIFSALGIVDIYINGKRVGNDEMKPGWTNYNKRAFYYVYDVSKYIHEGKNRILAVVSAG
WYSGRIVQSTYGANPPAFIANIVHGGKSILVTDENWDATVGGPVRMADIWDGEYCDATEN
GYDEISTVGFVPKKVRKATVCDYFNGVLTPFIGPKVQVRDELNLRAKTLTVYDGINYNGS
YYGEINICDNPKSFPLTLKKGQKLIIDLGQEMVGWAKLTLKGERGTFVNVHYAEFLNDSG
EISRGNDGAKGSLYTINFRTALAKETYVLSGKNEEVYRPAFTFYGYRYVQISSTKDIEIL
DFISEVVGSVTKEIGTLETSDELVNKLISNTLWGQRSNYLSVPTDCPQRDERYGWTGDAQ
AFSITAAYNADVKEFFRKWIQDARDSQGDDGGYTEVIPKTFCCHAENEAAWTDAGIIVPY
NMYVMYKDIELLETHYESMEKYIAQLVDKFGMAGANARFGDWLAYDQCDKTYVSSVYFIH
DIDLMIKMSDVLGKSDRAEHYKELRKQAYAYFVDNYMKDGKLIGQTQTDKILALAFDLVD
ADYAKVLADELVEQIKANGNRLSTGFLGTYNLCTTLSKYGKDKMAYTLLMQRNEPSWIYS
IDQGATTVWERWNSYTKENGFGDVGMNSFNHYAYGSVVEWMYRYMAGIEPGMPGFETVIL
RPRIDTRTAEELPDGQQRMTYVKASYDSSSGLIMSEWSNEKNLVYKCTVPVSTELRLPIM
GEKLTINGVEHSFDEYECKDGCAIIRLGSGEYVFEEK

Enzyme Prediction     

EC	3.2.1.40	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	259	776	8e-153	0.9841269841269841
CBM67	42	179	5.8e-17	0.7613636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.05e-120	372	705	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.08e-33	65	220	11	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.57e-26	263	367	7	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	7.19e-10	707	791	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD61991.1	2.71e-208	40	817	342	1148
QUT40529.1	2.71e-208	40	817	342	1148
BCA51920.1	1.51e-207	40	817	342	1148
QMW84969.1	2.12e-207	45	817	347	1148
AAO77630.1	2.12e-207	45	817	347	1148

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	3.63e-138	25	817	291	1031	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.00e-105	46	814	177	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	2.48e-98	59	757	146	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.90e-137	25	814	291	1028	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.33e-121	59	779	189	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.65e-106	59	758	185	856	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	7.09e-55	58	812	198	945	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999562	0.000426	0.000013	0.000003	0.000001	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001769_00619.