CAZyme Information: MGYG000001769_01646

Basic Information

• Species: CAG-488 sp000434915
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-488; CAG-488 sp000434915
• CAZyme ID: MGYG000001769_01646
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766		86774.98	4.7274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001769	2247196	MAG	Denmark	Europe

• Gene Location: Start: 3305; End: 5605 Strand: -

Full Sequence      

MKYSTRFISATKEYCEFLHFVPAPYLRKTFELDFIPEKAEMLVTGLGFYEFWLNGEHLTR
GCLAPYISNPNDLIYYDRYDLTDKLKKGKNVIAFALGNGLQNPIGGEVWDFQLARWRSAP
KLALCFECSGEGKEISFETDESFKVHASPIYFDDMRCGERYDARNEIDGWNLPDFDDSEW
NNAISVEAPSGECLEGSHALIKKIRELKPVNFYKGHISAIAHPRENLPEHILPEEEYCND
GYIYDFGENITGIVRLKIRGRKGQKIVMSCGESLFDGGLDMHNICEFQPIGMTQVQVYIC
NGEGEEIWEPMFCYHGFQYCFVTGIDDKQATEDLLTYVVMHADVPQIGGFDCSDELVNRL
QDATLRSDLANMFYFPTDCPHREKNGWTGDAHLSAEQFMMNLGAENTLREWLHSVRKSQD
ERGALPGIVPTGGWGFEWGNGPAWDAALTELPYRIWQYRGDKRVLEENATAIFRYVSYLS
TRLDEMGLVHIGLGDWLPVDNVKPCPLEVTDTLVSMGICEKAAEIFRVCDMPLRAEFAQK
LHDELRASFRKHLIDDNLVVYGNHQTTQAAAIYYGAFDESEKENAFAHLLELIHNANDNM
TVGIIGARTMFHVLAEFGYEELALHMIAKSDYPSFASWITEYNANTLFECITHNPPNGFS
HNHHFFGDISAWFIKNLAGIIPNADVCDPNYIVISPAFVGSMSYADGWYTAPAGKISVRW
ERNGDEIKLNVTVPDGVTGKIKLRHGAKFSGGENEIDIQSGEFIVK

Enzyme Prediction     

No EC number prediction in MGYG000001769_01646.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	240	743	4e-126	0.9861111111111112
CBM67	23	189	6.9e-30	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.54e-68	345	677	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.80e-34	36	192	3	159	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.04e-21	239	339	4	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.95e-09	691	743	11	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	2.95e-146	21	734	141	831
AVM44981.1	5.78e-140	22	757	49	757
QEL04107.1	2.61e-139	18	758	177	899
ANH83620.1	2.25e-138	18	766	135	873
AHF16194.1	4.48e-138	23	766	172	891

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.92e-101	23	743	176	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	6.23e-68	38	741	318	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.34e-66	27	761	135	859	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	3.89e-83	23	743	184	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	2.01e-70	25	741	172	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	3.08e-67	38	741	318	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.60e-62	25	743	176	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001769_01646.