CAZyme Information: MGYG000001770_00782

Basic Information

• Species: Prevotella sp900313215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900313215
• CAZyme ID: MGYG000001770_00782
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000001770_14|CGC1	37017.49	10.0068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001770	3003526	MAG	Denmark	Europe

• Gene Location: Start: 10451; End: 11446 Strand: +

Full Sequence      

MKKKLSLLLCLAMTLFVMTSSTKITTIFVIGDSTAAEKSNFKDNPERGWGMVLQGFFDDK
ILVDNHAVNGRSSKSFINEGRWQKVLDRLKPGDYVFIQFGHNDEKPKPDRHTDPGSTFDA
NLRRFVEETRQKGGIPVLFNSVVRRCWYAENLKNDDDEKLRKTVFDGEEKINSDTLIDTH
GAYVVAPRCVAQELNVPFVDATKITHDIETSLGIKGSRSLHMWYKPGEVPSIPKGRMDNT
HYNVYGARIIAGALADAIGKVVPALGKHVRHYDYVVSAEGRGNFMTLQDAVNAVPAGKKT
TILILGGKWNKPTGTQGKKIKYVKYWGAKVK

Enzyme Prediction     

No EC number prediction in MGYG000001770_00782.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	26	258	2.4e-74	0.9952380952380953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	9.02e-81	25	258	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG2755	TesA	1.75e-21	18	265	2	215	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
pfam13472	Lipase_GDSL_2	7.15e-10	29	207	1	153	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	1.52e-08	27	257	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01838	Isoamyl_acetate_hydrolase_like	7.64e-06	27	200	2	161	Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash. The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66075.1	3.28e-189	3	331	2	330
AGB27919.1	1.46e-146	10	330	11	330
BCS86649.1	3.43e-138	27	325	11	308
QIM10157.1	1.05e-129	4	325	7	327
VEH15653.1	1.13e-118	27	330	26	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DEO_A	3.15e-15	25	258	1	212	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	1.51e-14	25	258	1	212	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]
2O14_A	1.96e-13	26	138	164	274	X-RayCrystal Structure of Protein YXIM_BACsu from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR595 [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	5.30e-43	27	281	8	229	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
O31528	4.89e-27	27	258	5	202	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
Q00017	2.23e-14	25	258	18	229	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1
Q5BAA2	7.23e-14	26	258	19	224	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1
P42304	1.86e-13	26	138	179	289	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.092398	0.732464	0.174327	0.000264	0.000244	0.000280

TMHMM  Annotations     

start	end
7	29