CAZyme Information: MGYG000001770_01578

Basic Information

• Species: Prevotella sp900313215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900313215
• CAZyme ID: MGYG000001770_01578
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		43299.3	8.2729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001770	3003526	MAG	Denmark	Europe

• Gene Location: Start: 19360; End: 20544 Strand: -

Full Sequence      

MFLGCSSKKEQPELTPWGTPVGEVEVSDEPAPQSQGKGLSLDDIVSGGELIMLTVNGPTT
YYDYHGHGMGLQYLLCEKFAQQIGVSLRVEECKDTAEMVSKLKKGEGDLIAVPLARVKAK
GGLLFCGVKSDDEQWSVAAGNKSLADTLNSWFKPKMIAEVKQEESFLLSSRSISRHVYSP
FLNRSKGVISKYDRLFQMYAGAARMDWRLMAAQCYQESCFDPNAKSWAGACGLMQIMPST
AAHLGLPMSQVHEPEANVAAAARYMAELQGHFADVGDPSQRILFALAAYNGGFHHVRDAM
SLARKHGRNAYNWGDVREFVLRLSQPAYYSDPVVKYGYMRGLETADYVDRIRARWADYCG
VAGGSRGFSGGSIGGGFHGAPVKAKRKYSNKYHL

Enzyme Prediction     

No EC number prediction in MGYG000001770_01578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	205	354	4.7e-27	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	7.56e-75	196	359	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	2.21e-53	32	352	27	444	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	5.97e-48	41	352	16	425	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13401	Slt70-like	8.16e-26	192	297	6	112	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.19e-23	196	311	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65891.1	1.08e-225	1	394	15	419
QUB48180.1	3.53e-156	5	394	19	392
ALO48082.1	1.38e-155	2	394	15	391
VEH15587.1	2.06e-155	1	383	44	411
BCS86517.1	5.39e-155	1	362	1	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.01e-21	189	352	256	415	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.06e-21	189	352	263	422	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	1.06e-21	189	352	263	422	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA4_B	1.18e-21	189	352	249	408	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	1.18e-21	189	352	249	408	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	2.29e-29	80	351	166	441	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q0AQY9	1.40e-27	181	352	278	445	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
A0KJ50	2.02e-27	41	352	40	447	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
B1KLC4	8.33e-27	90	352	170	435	Membrane-bound lytic murein transglycosylase F OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=mltF PE=3 SV=1
A6TCH2	1.06e-26	44	352	39	445	Membrane-bound lytic murein transglycosylase F OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.849856	0.000175	0.149993	0.000000	0.000001	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001770_01578.