CAZyme Information: MGYG000001770_01839

Basic Information

• Species: Prevotella sp900313215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900313215
• CAZyme ID: MGYG000001770_01839
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		44663	8.5186

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001770	3003526	MAG	Denmark	Europe

• Gene Location: Start: 9213; End: 10367 Strand: +

Full Sequence      

MISTNKPAFRCSDETFNEIWRVCERSVWQHPGQDPVTAHADSMADHTFYWFLSIYEHYLY
TGNERCVRQAYPRMRKFINYCLSHTDSNGMIQIKSDDQVFVDWLPENRDRKGLRSFEQIL
YCKSLEDMAQCAHLLGRKADEERYFAHFTRLRKQILPSFWNEKRQALVHRVVDGRRSRLI
TRHSNVFAIFFDYFTEAQKQEVASTVINNPFVKPFTSPFMQFYELAALCSLGNLSQVLER
IRKQWNSSILKAQLSSPKAEVDEKLCYAWGICFLYLFGRYFLGVKPVKPGYEEFEIRPEL
GGLEFIEGKIPLPKGEISVYRNADLIRIQASSGSGYLYFSSSLPPKASRGEIEKFIGKNQ
YRLWIDAGDEVGVTLTQSPSSKMT

Enzyme Prediction     

No EC number prediction in MGYG000001770_01839.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	40	320	1.4e-53	0.5575396825396826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.88e-15	9	203	6	247	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.12e-04	283	319	1	38	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77830.1	2.27e-107	6	374	298	725
SCD21489.1	2.95e-106	26	373	368	730
ALJ42159.1	2.03e-105	24	374	361	726
AAO76108.1	2.03e-105	24	374	361	726
QMW89333.1	2.03e-105	24	374	361	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.12e-100	24	374	363	728	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	3.30e-09	55	319	574	853	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	4.19e-07	52	317	814	1108	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001770_01839.