CAZyme Information: MGYG000001770_01974

Basic Information

• Species: Prevotella sp900313215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900313215
• CAZyme ID: MGYG000001770_01974
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560		65433.2	9.8604

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001770	3003526	MAG	Denmark	Europe

• Gene Location: Start: 18264; End: 19946 Strand: -

Full Sequence      

MFHLSKKNKAVIAILSLLLVFMSCGWYVWSCYHMTQERWMRAKATVDVCCHYELRAGNKI
LLDLGNDTTKLDAFFVNQYDLLPSCKGLLLAEDNAAIRYKRYQGMTPQQVYHAQIDSLQT
IYKNAKWTLHEIDYYTHSHNVRDEGYGMIADYEEQQKVRFEKAKKLLDSLHHTVDTTSLR
IVRQLSYKVLYISQLSTRQLSSQSCQLEKHDMQKGMNYFRLSSQALPDSACAINQRNAFY
GIKMDVVPFCQSFVKVMQADSEGIYTGERDSLFHPHGHGMWMGNDGSHYEGQWKHGHRDG
FGFGIESGKQLCVGEWKNDRYRGERLVYTYDRIYGIDISKYQHIIGKKKYPIQWSKLRIT
HLGNISRKTVNGSISYPISFIYIKCTEGASLLNPYYRKDYRAAKAHGFRVGSYHFFSPRK
PGLAQARKFMKHALVRRGDFPPVLDLEPTPRQIKQMGGPDAMFAQVRAWLRYVERQTGTR
PILYISQMFVNRYLKYAPDLKRNYRVWIARYGEYKPDIRLVLWQLCPDGRVRGIRGHVDI
NVFNGYRDAYQKFLQNEVVK

Enzyme Prediction     

No EC number prediction in MGYG000001770_01974.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	336	534	2.1e-37	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	2.32e-43	334	545	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	3.60e-43	333	545	3	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	2.06e-42	334	543	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
COG3757	Acm	1.22e-35	333	554	63	264	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
pfam01183	Glyco_hydro_25	1.36e-34	336	534	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67810.1	1.18e-159	214	560	7	353
ALO48884.1	5.03e-135	241	559	84	402
QUB47627.1	5.38e-135	252	555	100	403
BBA29745.1	3.31e-130	74	555	91	572
QUB57104.1	9.33e-130	74	555	91	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	3.26e-17	333	553	16	216	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
5A6S_A	2.25e-10	358	557	17	212	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X7H0	1.84e-28	333	554	67	265	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	3.44e-28	333	554	67	265	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	3.44e-28	333	554	67	265	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P26836	1.27e-12	363	543	19	196	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.481905	0.013837	0.495924	0.000137	0.000082	0.008113

TMHMM  Annotations     

start	end
10	32