CAZyme Information: MGYG000001771_00098

Basic Information

• Species: CAG-617 sp000438115
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp000438115
• CAZyme ID: MGYG000001771_00098
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000001771_3|CGC2	40823.67	8.4926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001771	1494481	MAG	Denmark	Europe

• Gene Location: Start: 28227; End: 29291 Strand: -

Full Sequence      

MKNKLKKAFVLSGLSLMLLAQPALADHRYILPEPSTSPSKAQQQQIKRQYGMFIHFGINT
FHDEEWTDGSKPASSYAPPVIDAEQWIKTAKDAGMKYVILITKHHDGFCLWDSRYTEYDV
ASSGNTTDVVTAVAKACKKYGIGLGLYYSLWDRKVNPEVNDPSKDAAYNAYMLKQIDELL
QKVRAQRVPLVEFWLDGGWTKQNYRWPILQIYQAIKSREPNCQIGVNWSIGSPQNADTHP
VLPDQQKEGYPIRYFPSDFRLGDPYLPTDNDPKLFTYNGQQYYMPWESTVCISQCWFYNS
KDLKYKTVDELEKLYRQCTKNDNILILNCPPGTNGKMRDKDIQILMELKKRLGI

Enzyme Prediction     

No EC number prediction in MGYG000001771_00098.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	25	350	1.5e-68	0.8988439306358381

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	1.14e-44	51	354	28	330	Alpha-L-fucosidase.
COG3669	AfuC	2.67e-42	38	348	8	308	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	6.83e-40	51	354	29	332	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24265.1	1.35e-210	6	354	3	349
QCQ35196.1	3.79e-197	7	354	2	347
QTO26593.1	7.64e-197	7	354	2	347
QCQ30777.1	7.64e-197	7	354	2	347
QOD59462.1	4.09e-179	26	352	20	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	4.69e-42	38	347	32	347	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	7.10e-37	38	353	19	348	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
5K9H_A	1.28e-36	38	353	39	353	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
6ORG_A	1.30e-36	38	347	11	314	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	6.51e-36	38	347	11	314	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	8.93e-41	30	350	34	338	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	2.63e-38	38	347	40	336	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	5.57e-13	49	206	41	232	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q9VTJ4	3.41e-12	73	206	104	238	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
Q60HF8	1.05e-10	20	239	33	274	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000320	0.998940	0.000234	0.000175	0.000166	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001771_00098.