CAZyme Information: MGYG000001771_00769

Basic Information

• Species: CAG-617 sp000438115
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp000438115
• CAZyme ID: MGYG000001771_00769
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
961	MGYG000001771_49|CGC1	107335.97	5.1199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001771	1494481	MAG	Denmark	Europe

• Gene Location: Start: 1005; End: 3890 Strand: +

Full Sequence      

MFSTALALTLPAPSLLAQQADISPLPQSVSWGSKAFDATTAYVIHGADTADSLSVALLRS
SLQTAESGGISITIGQSGDEAVSAYETKIPAQAQGYYLSVGPEGVVIAGRDDIGTYYGVQ
TFLQIAAQPEVMSVSITDYPNVLERGVVEGFYGNPWSETDRKRQFAFYGANKMNIYIYGP
KDDPYHRNRWRENYPAEKAAELKRLIEAAHKYKVQFTWALHPGLDIKWNKTDSLNVLNKL
ESVYQLGCRRFAIFFDDISGDGGKAANQAALLNYVTEEFIHKHNLEPLIMCPTAYNRASM
SGDYLQVLGANTDPEVHIMWTGNSVVDMINKSDLDYVNPIIKRNAYIWLNYPVNDYCIDH
MLMGKLYGNDQNIATQLSGFTSNPMEYAEASKVALFSLADYTWNMADYNPQQSWERAISY
LMPEHKDAFRTFCESNVDLGSTYHGLRREGETPDFTAPAVSFKASVDTGYNEQKATAVRQ
QFDNMVNAAGELLQSTEEPELIAELTPWLQVMKLQAQRGQKLMDLFKFIHEEKPDSFIDT
YLQMQELEKEQKNIRSRDFEGSIKNPNPAVATTYVAPFLTEMTSRAVAEYKKNFDYRLDV
FPTVLLEDGRYYIKYNNQYLTNNGSATSLGDYPTFKATMDQTNPQRQEWNITMDYSTNRY
KIVNANDGRYLNELGTFAKSNDLNPYEAAWHTYNMLRTNGKYCIQNAGSAGDKYWTVSNG
RINQGSSNAWNINNVIFELQPTDSARTYPLIEEGKTYYIKSGDLYLTSTNLYGTGGTPTF
KAKQASNLNQKWKFSIDATTGRYKLVNGTDNRYVNELGNFGTNAYYPSWNSYIITELGGL
FSIQNAGEGGSNFWLVSDNRISPAAANRGDSYIFEIVSTELPSGINGTTQDEAMLTYRID
ANTLQVGGRTGITGLQLYDSAGRAVASSRGSNVISITGLPKGTYVLSVKGTGWNTSAKIK
L

Enzyme Prediction     

No EC number prediction in MGYG000001771_00769.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	145	433	2.2e-108	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	3.53e-161	145	432	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	1.16e-13	21	138	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
TIGR04183	Por_Secre_tail	0.008	900	959	8	69	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13183.1	1.47e-269	16	727	21	720
QUB43766.1	3.05e-192	6	669	7	667
AZS29316.1	1.54e-153	15	593	18	600
QUT42280.1	6.20e-153	7	599	11	606
QMW86728.1	2.43e-152	7	599	11	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	8.86e-154	7	599	11	606	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	4.01e-153	17	599	3	588	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2WZI_A	4.87e-153	7	599	11	606	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]
2WZH_A	4.87e-153	7	599	11	606	BtGH84D242N in complex with MeUMB-derived oxazoline [Bacteroides thetaiotaomicron VPI-5482],4AIU_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	5.16e-153	18	599	1	585	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	4.85e-153	7	599	11	606	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	3.26e-86	21	457	45	503	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	3.26e-86	21	457	45	503	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	7.21e-47	21	489	40	557	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	2.58e-41	146	409	63	337	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005150	0.993723	0.000241	0.000345	0.000257	0.000255

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001771_00769.