CAZyme Information: MGYG000001771_00855

Basic Information

• Species: CAG-617 sp000438115
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp000438115
• CAZyme ID: MGYG000001771_00855
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1115		123953.93	4.7769

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001771	1494481	MAG	Denmark	Europe

• Gene Location: Start: 1432; End: 4779 Strand: -

Full Sequence      

MKKIKKYISLCACCTLPVLAYGQTTNGVDFETADSYKAIGVYDTWENSPFRTGQLQGNVQ
VVNNHLNEVDEEMGITPNGTKKILAVQRSRFGSNTFGARVDLKNTFELTTTTQYVHVFIC
TPTSGRVMLVGLGKRRERVDQSPEAEQFWVLSTTKTEPGKWFDAVFPIKGAGGIDIHSLV
VVPDCESPHTLTSDFAAYIDEIEINGESAPRFRRGDYVLNFDTDEVSNKSGNYLNSISLN
GSAGGDQTFSVGSQNPQLLYRPMLDKMFMAKAGEKLTPAFNFSASWMNGYVYLDRGNDGK
FSYELNSNYTIPEGSDIMSYSYVETVENTEGYISDGSKISGNARNFINPPAFTLPADLAS
GFYRMRFKVDWGNVDPAGRMTTTNSIKENGGMIVDVMMDVHGDNVSVSTASRNGEVMTSD
DQKINNLQVPYNKPFVIKMRPEKGFSYEGVKVTYGYNLNGDSLVHGNPQYFTVTYPAYLF
RNDELTLPAEIMRGGAVSIEGLFVEQKGDEPEVEPGKEYPVSFDKSEVIGRDDRKLNSFT
LNATRGGSKTVTIPASDNHVYQNMLSKEVSVIPGDEVNVTVNYTGHSMHEYLYVDLNQDG
KFSALLNTDGTPTMSSELLSYTYYEGKNSEGTVISSLPGEVSMESMPSFTLPANLPAGVY
RARLKIDWNEIDPSGNSSQTLADNAGYVVDFLLNVHQASHPLEVNTVNGSINGSGYTGLP
LNVPCFQSLTIVPTPAASGYEAEFITIRHGHNFDGPQYVYGNRQGSEYTVPVNRTYTIPA
DSVNGDLVLTANFEPTESAAYKLIYADEFNGSDGSQPADTVWSRCKRMSSTWNRWLSDSE
KVIYVKDGKLVARAIPNPDQATDNVPMITGGIQSSGKFSFKYGKIEARILTNPHTGNFPA
FWLMPEDQHDGWPTCGEIDIFEQIDNENKAYHTVHSNWTYNLGHKTDPQSSFNETVSMDR
YHTYGFEWTATDMKWYVDGRQVGSYTKKESDANALNQGQWPFDKPFYIILNQSVGNGSWA
QNADVNHTYETLFDWVRVYQKEDSQVGISTIPETDDAVEIHTEKGVLNLNAVNPVRVQVY
DAGGRCFYDNVLKGNKKLSLQQGTYFVNRQKVFIP

Enzyme Prediction     

No EC number prediction in MGYG000001771_00855.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	806	1039	4.1e-54	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.06e-65	807	1039	3	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	3.55e-32	807	1039	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08024	GH16_CCF	6.77e-26	803	1015	1	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	1.00e-22	801	1040	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd02178	GH16_beta_agarase	2.00e-22	805	1040	25	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	9.60e-174	3	817	6	803
QFQ13169.1	3.92e-115	511	1041	17	542
QUB75565.1	1.83e-86	780	1087	28	332
QUB87116.1	1.74e-84	801	1087	48	332
AKU69476.1	1.74e-84	801	1087	48	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	4.76e-38	796	1040	24	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
4CRQ_A	8.41e-29	801	1041	3	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	1.26e-27	872	1043	70	235	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	7.89e-27	872	1043	70	235	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
3ATG_A	3.66e-26	803	1039	5	238	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	2.87e-39	801	1040	56	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P23903	2.87e-24	743	1042	366	682	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
P45798	7.64e-22	876	1040	114	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	7.28e-17	800	1015	19	237	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q8N0N3	3.03e-14	866	1015	130	301	Beta-1,3-glucan-binding protein OS=Penaeus monodon OX=6687 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000877	0.943764	0.054412	0.000294	0.000337	0.000300

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001771_00855.