CAZyme Information: MGYG000001772_00127

Basic Information

• Species: CAG-831 sp900550465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900550465
• CAZyme ID: MGYG000001772_00127
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	MGYG000001772_1|CGC2	45304.91	4.684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001772	2209907	MAG	Denmark	Europe

• Gene Location: Start: 146636; End: 147850 Strand: +

Full Sequence      

MFIVNWNRSTVAFLTAVLLSVFPAGAQQAIWSTRAVTSPEVYPDGRVTFRLFAPKAVEVW
VEGDFLSDSLYGDSQGNYRAELREGEDGVWEHTTPPLRSELYSYTFRVDGLKVLDMSNVF
IKRDVSSLTNYFIVEGNPGDLYSVQDVPHGTVSKVWYESPALGTVRRMTVYTPAGYDSGK
GRYPVLYLLHGMGGDEEAWSDLGRAAEILDNLIAAGRCLPMIVVMPNGHVFNDAAPGQTP
GGLEQPDFNRSGEAACTMEESFPDILNYVEQHYRVRKDKASRAIAGLSMGGGHAMNISRM
YPDMFDYVGLFSAAVMPREKRTDGGSAAGAYSDIESSLAVQFSKEPALYWIGIGKEDFLY
GYNEDYRAFLDSHDWPYTYYENGEGHIWRNWRIYLAEFLPLLFR

Enzyme Prediction     

No EC number prediction in MGYG000001772_00127.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	159	400	2.6e-54	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11294	E_set_Esterase_like_N	2.59e-30	45	134	1	82	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	1.43e-27	93	404	14	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG0627	FrmB	4.28e-19	169	402	38	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.48e-18	159	318	1	148	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd02858	E_set_Esterase_N	2.02e-09	45	115	1	59	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH98968.1	3.96e-159	12	404	5	397
AST55403.1	3.96e-159	12	404	5	397
QUT21362.1	5.61e-159	12	404	5	397
ABR44406.1	5.61e-159	26	404	19	397
QRO15451.1	5.61e-159	26	404	19	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	3.27e-100	25	404	11	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	3.66e-49	39	404	40	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	9.48e-43	39	404	17	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	9.70e-43	39	404	17	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6NE9_A	1.13e-42	39	404	42	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	1.32e-43	39	404	329	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.35e-33	40	312	42	303	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	1.69e-29	147	401	46	275	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	7.91e-27	39	404	395	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P35866	9.01e-06	173	397	186	413	Uncharacterized protein Cgl0967/cg1104 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=Cgl0967 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.026545	0.938073	0.033627	0.001141	0.000307	0.000274

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001772_00127.