CAZyme Information: MGYG000001772_00274

Basic Information

• Species: CAG-831 sp900550465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900550465
• CAZyme ID: MGYG000001772_00274
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277	MGYG000001772_1|CGC5	31964.66	6.1486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001772	2209907	MAG	Denmark	Europe

• Gene Location: Start: 321384; End: 322217 Strand: -

Full Sequence      

MKDPKRVLFVNSEIYPYLPETEISIIGRYLPQGIQESGKEIRTFMPRYGCVNERRNQLHE
VIRLSGMNMVIHDIDRPLVIKVASISSARMQVYFIDNDDYFHRKTIYETEDGKFMEDNDE
RAIFFARGILETVKKLRWKPDIVHCSGWISYLVPLYLKKAYKNDPIFSDAKVVVSLYNEY
PEAEFSPDMKTKALTSGVRAKDVEMLKTPNGINLAKLAIQYADAAILGAENISPEVTAYI
GSRKLPVLEYMPIDRTEGTYIQKYNQFYDNLTDSDAQ

Enzyme Prediction     

No EC number prediction in MGYG000001772_00274.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	6	231	4.2e-44	0.4555084745762712

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	9.81e-54	7	224	1	212	Starch synthase catalytic domain.
PRK14098	PRK14098	9.46e-43	6	224	7	223	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.09e-33	6	224	1	211	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	3.45e-24	6	224	2	200	glycogen synthase GlgA.
COG0297	GlgA	4.08e-18	6	224	2	211	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY54414.1	4.71e-121	18	271	1	254
QKG78761.1	2.96e-117	6	272	7	273
QIA09804.1	6.03e-116	3	271	2	266
BAX80299.1	1.10e-114	6	271	5	266
QGY44407.1	4.02e-114	3	271	2	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNF_A	7.82e-08	6	238	23	281	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]
6GNG_A	2.61e-07	7	185	42	227	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	1.14e-42	6	223	7	222	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
A1BIY8	1.17e-40	6	231	7	241	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
Q3B6C3	3.16e-40	6	223	7	222	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B4S584	3.26e-40	6	224	7	223	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
B3QR00	4.34e-40	6	238	7	237	Glycogen synthase OS=Chlorobaculum parvum (strain DSM 263 / NCIMB 8327) OX=517417 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001772_00274.