CAZyme Information: MGYG000001772_01457

Basic Information

• Species: CAG-831 sp900550465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900550465
• CAZyme ID: MGYG000001772_01457
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000001772_8|CGC1	39111.8	9.7701

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001772	2209907	MAG	Denmark	Europe

• Gene Location: Start: 3361; End: 4368 Strand: +

Full Sequence      

MRQTLNFNTIRTIIKGAAAAIILLLAVMPGYGQQRLTRQEYIDKYKDAAIQAMKTHGIPA
SITLAQGCLESGDGNSDLAVKANNHFGIKCHNDWKGPTYYKKDDDPGKSCFRKYRNPAES
FKDHSDFLRYRDRYAFLFDLEITDYKAWCHGLKKAGYATDPQYAQRLIKIIEDYQLYRFD
REMYAKAEQNRNLLPPSPNEIMKVMELNPARTSLLYKYSRNRIIYQRNGVPYILAGNLDT
YESIAGEYNLFTKELLRYNDLKKSRDLLPGTVVYLQRKKAKAQRHMEIHIAVEGDTYYDV
SQKYGVRMKKLFKYNDYKSGDILHIGDEIFLRRHR

Enzyme Prediction     

No EC number prediction in MGYG000001772_01457.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	47	176	9.1e-38	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.14e-43	39	181	44	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	7.71e-42	35	180	157	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	7.22e-30	46	176	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	1.46e-28	39	180	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	5.35e-20	39	171	149	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53917.1	1.53e-120	14	332	4	312
QKG80574.1	6.94e-89	33	333	24	309
QDH54809.1	9.46e-89	40	332	32	301
QUT24741.1	9.46e-89	40	332	32	301
SCV10623.1	9.46e-89	40	332	32	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZYC_A	1.06e-12	39	193	3	163	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3VWO_A	1.65e-12	39	171	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3K3T_A	6.92e-12	39	193	3	163	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	2.87e-11	37	182	60	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	9.45e-11	39	172	4	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.98e-15	38	180	48	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9KQ15	2.36e-14	37	178	160	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9X9J3	1.78e-12	39	170	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	7.55e-11	40	178	241	389	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
Q2G222	2.51e-10	37	182	320	474	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000685	0.998428	0.000231	0.000231	0.000193	0.000181

TMHMM  Annotations     

start	end
13	32