CAZyme Information: MGYG000001772_01478

Basic Information

• Species: CAG-831 sp900550465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900550465
• CAZyme ID: MGYG000001772_01478
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000001772_8|CGC2	42891.54	8.658

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001772	2209907	MAG	Denmark	Europe

• Gene Location: Start: 28182; End: 29330 Strand: +

Full Sequence      

MKYYIIAGEASGDLHGSNLMRGLLAHDPSCEIRFWGGDRMAAVGGTLVRDYRDNAVMGLV
EVIGRLGSILRNLRFCKKDILGWKPDAVILIDYPGFNLKIARFAHEHGFKVFYYIPPKVW
ARGEGRIRLLKKYVDRTFIIFPFEVPYFEAKGVNAVYNGNPLVDNIAATPSVHMTREEFL
RSHSMTDDGRELIALLAGSRKMEVDYLLPRLVRTAAILKERTGSRFRFLLAAAPSIDRSY
YDRYLHGNPDIEVIYGDTYGVLSHSAAAAISSGTASLEAAVIGTPQVVCYGMNPITYAIA
RMVVRLDTISLANMILGRHIFRELLQGDCTPEHIAGELLRMTDDTAYRSRMLSDYDDMRA
LLGEKDSARRTAADIERLIKEK

Enzyme Prediction     

No EC number prediction in MGYG000001772_01478.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	362	2.6e-112	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.41e-105	1	382	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.43e-100	1	375	2	374	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.08e-76	4	339	2	336	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.55e-73	5	376	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.53e-42	1	378	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53532.1	5.35e-129	1	369	1	360
ASB47927.1	2.94e-113	1	372	1	368
QKJ32584.1	5.01e-112	1	372	1	360
ADY50863.1	5.55e-111	1	372	1	359
AYL97782.1	5.92e-111	1	372	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.48e-43	5	339	11	342	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.86e-43	5	339	11	342	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	1.19e-78	5	381	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	1.20e-75	2	372	8	373	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	1.48e-73	2	372	8	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	5.70e-73	2	372	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q6ALW0	1.19e-69	5	338	14	346	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001772_01478.