CAZyme Information: MGYG000001772_01538

Basic Information

• Species: CAG-831 sp900550465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900550465
• CAZyme ID: MGYG000001772_01538
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635		70977.34	4.5292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001772	2209907	MAG	Denmark	Europe

• Gene Location: Start: 98831; End: 100738 Strand: -

Full Sequence      

MRRYPVFSVLTLLVSLLAVSCDSRGSAGLRYDFGDIIDIVLTPDSTVRRAGCFTDAGSWM
GFTLPQRDSRLNGFCGPFSIEHRLWMAQAAVTVGFAGDEGVMQPDSLTYFPGEVFMSSSS
EAGRMEQRMVFADRTTALLAVSGDSDAGFVFAGKGWNSRVRLGMRKNTVVAEHPSGETVL
LTFSPGTEVSCSGDNYSARTAEGCRNTWVAVSFCYEGDDVEAVRQGAVAMLGDPEQVVAA
NSARWEGYLSRVLRNDMPHEYDRVAVKSVVTLISNWRAARGDLFHEGVIPSHSVTYFTGF
WAWDSWRFSAALARFAPELARNNIRAMFDYQQPDGMVIDCIYTDSRWNNARDSKPPLACW
AVDEILTYAGDTSFVREMYPKLLAYYKWWFAKRDHNGNGMCEFGSTDGTLEAAGWESGMD
NAIRFDGASMLRNGPDAWSLDQESVDLNAYLAFEARLLRKFAALIGEDFDAPDYSAEVAE
YFFDPELGYFCDRRLADGSFIAEPACEGYTPFWVEIASQEQMDQALRLLTDPAKFSTYIP
FPTAAADNPKCSPDGYWRGPIWLDQTYQAIRGLRNYGYGDLADEYTRQVFDRCDGLTGYA
PIHENYGTHTGERLQASHFSWSASHLLMMYEDYGK

Enzyme Prediction     

No EC number prediction in MGYG000001772_01538.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	201	633	2.9e-108	0.5421052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	5.30e-129	53	633	59	783	alpha-glucosidase; Provisional
COG3408	GDB1	1.15e-19	301	630	285	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	1.37e-11	372	631	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	2.13e-09	335	634	151	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	0.001	413	587	324	497	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37311.1	0.0	11	635	3	638
AND18792.1	2.74e-299	2	635	3	644
QQY39153.1	5.52e-299	3	635	4	644
ABR39053.1	5.52e-299	3	635	4	644
QUT86878.1	1.11e-298	2	635	3	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	3.47e-75	48	633	27	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.79e-74	48	633	27	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	2.48e-74	48	633	27	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	6.39e-71	48	633	28	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	8.37e-33	438	633	93	305	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	2.82e-74	48	633	50	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.79e-19	301	624	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	4.22e-19	301	624	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P53008	8.67e-06	372	576	538	762	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000041	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001772_01538.