CAZyme Information: MGYG000001772_01645

Basic Information

• Species: CAG-831 sp900550465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900550465
• CAZyme ID: MGYG000001772_01645
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728		80197.56	4.6493

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001772	2209907	MAG	Denmark	Europe

• Gene Location: Start: 93862; End: 96048 Strand: -

Full Sequence      

MKTLACLMLCCGLMSWPLCGQPRYKDASLPVEERVEDLLERMTLEEKILQLNQYTLGASD
NANNIEEVTARIPAGIGSLIYYEENPELRNGMQRRAMEQTRLGIPILFGYDVIHGFRTVY
PISLAQACSWNTDLVREACDMAAAEARRSGVDWTFSPMIDVARDGRWGRISEGYGEDPYT
NAAFCAASVEGYQGSDLSSSAQVAACLKHYVGYGASEAGRDYVYTEISRQTLWDTYLPPY
EAGVRAGAATVMSSFNDISGTPATCNAYTLSEVLKGQWGFGGLVVSDWAAVPQLIPQGAA
ADRKEAARLAVNAGLDMDMVGHCYDNYLDSLVREGAVSEERIDDAVRRVLTLKFRLGLFE
QPYTGEVPADQRLLLPQSRELAERLAEESIVLLKNEGGLLPLQGQRTIAVLGPIVDAPGE
LLGSWSGHGRGEEVYPVRDALTEEFGGTSQVLFHAGCPFDGDDRSGFASALETAREADVV
VLFMGERRGWSGENGSRSSIELPEIQEEFIVEMQKAGKPMVLVLSSGRPLALQRVEPLCD
AIVEMWQPGVPGGRPVAGVLSGRVNPSGKLSVTFPRTTGQIPVYYNRRQSSRPRQGLYQD
IPSTPLYEFGHGLSYTAFEYGDLKLSRESVTGGETLTAEISVTNTGERDGAETVHWFISD
PACRITRPLRELKHFEKQVIPAGETRVFRFGIDPARDLSFVDSDGNRFLEPGDYYIMVKD
RKVRLQVY

Enzyme Prediction     

No EC number prediction in MGYG000001772_01645.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	97	320	3.4e-70	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	718	1	750	beta-glucosidase BglX.
COG1472	BglX	5.17e-105	42	431	1	378	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.62e-84	15	720	39	770	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	5.16e-83	43	352	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.80e-62	390	615	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGU13705.1	0.0	11	727	9	734
QUT64936.1	0.0	11	727	9	734
QUU00468.1	0.0	11	727	9	734
QUT62248.1	0.0	11	727	9	734
BBK85739.1	0.0	11	727	9	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	7.24e-173	35	718	14	737	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.06e-172	35	718	14	737	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	1.25e-169	32	718	4	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	7.03e-169	32	718	4	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	7.25e-169	32	718	5	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	1.60e-166	1	726	1	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	3.19e-166	1	718	1	750	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	1.92e-119	48	718	9	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	4.61e-115	31	721	35	764	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	1.66e-114	24	718	29	740	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.999104	0.000199	0.000138	0.000132	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001772_01645.