CAZyme Information: MGYG000001773_00561

Basic Information

• Species: CAG-475 sp900550855
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; CAG-475; CAG-475 sp900550855
• CAZyme ID: MGYG000001773_00561
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		99068.98	7.7506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001773	1468458	MAG	Denmark	Europe

• Gene Location: Start: 4469; End: 7051 Strand: +

Full Sequence      

MYKKNRKNFIDLCGQWTLLDPVSRKEYPASVPSCNYSDLQNAGVIPDPFVALNEKQTEWV
SKQDWVYEKTFDLTREDLFADRIFLNFEKIDTLCDVTLNGEKIASVSNCHIPYSFEVKKF
LKEGENKLSLYFPSPVNAVIQKQKSIKCPVNNNGLTGIAHLRKPQCHFGWDWGPVIPVSG
IEGDVKLVFSNKGRILQTRVGQIAEDGGVRLHTEIQNEIYSDDTLELDVKLVCPSGETYE
ARAVAKDKNIVEFLVEKPLLWYANGMTNCHEQPLYTIETTLLSGDCVLSSLKKQIGLRTI
TLDRSRDKYGSNFCFYVNGKRVFAKGANWIPTDSYPTRTTRKDIEEYLKIARDSGFNMLR
VWGGGGYESEYFYDLCDRYGILVWQDFMFACQAYPFFDDEFLQNVKEEVKHVANRLADRA
CLALWCGNNEIEAMTAGWATRRKFVKWTKTFFYDILPSELKKYDDITPYIEGSPVGTKFL
KNVGSDNVGDVHLWAVWHGFQPLAYYKTRNPRFCSEFGFESMPDLKTVEKFATKEDFDLS
SKVFSSHQKCRGGNEKIKFYIAERYRLPKRFEDYVYLSQLCQSLCVGEATEHWRATERCN
GSLYWQFNDCWPTCSWSGLDYYKNYKAVQYEAKKFFAPFSLAIEREKNGVNVVVFNDNIA
AQKGVLDVKVETFDGKELFFEQIPVEVDGCSTVVAKQYDARKFGGKKVLKNAVFVATLTC
ENPQNVAECQPKTIRKTMLFGKEKNLNLPKANVTVDVHREGNKAIYTIKSDAFVSKFALF
TQNNSPLSDNYFDVLPNETVRISQTMDDGCTLEVLKNNFKFKHVATIEPKSSKFVDSFFR
FKTLLSTWNFLNYIWYKFFM

Enzyme Prediction     

No EC number prediction in MGYG000001773_00561.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	750	1.3e-101	0.7539893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.52e-95	9	638	12	631	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	4.48e-08	35	383	89	394	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	3.01e-07	750	825	1	77	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	1.01e-05	204	298	15	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	2.84e-05	650	728	3	81	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98156.1	3.19e-200	12	858	6	855
BAJ62595.1	5.56e-178	16	813	14	814
AUG59052.1	6.41e-174	10	822	3	812
CUS03525.2	7.64e-170	12	809	6	800
QNK42494.1	6.41e-168	10	794	3	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.42e-148	10	796	27	802	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
7OP6_A	1.17e-142	16	823	17	844	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2VJX_A	2.12e-142	16	802	15	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.24e-142	16	802	17	816	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	3.06e-142	16	823	15	842	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	1.93e-102	30	652	31	669	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
I2C092	9.57e-100	21	683	27	721	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
A1CGA8	7.82e-99	16	652	13	669	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
B8NW36	4.00e-97	31	652	32	669	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q2TXB7	1.49e-96	31	652	32	669	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001773_00561.