CAZyme Information: MGYG000001774_00178

Basic Information

• Species: CAG-831 sp000432775
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp000432775
• CAZyme ID: MGYG000001774_00178
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000001774_1|CGC3	42679.6	9.0706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001774	2596897	MAG	Denmark	Europe

• Gene Location: Start: 202761; End: 203909 Strand: +

Full Sequence      

MKYYIIAGEASGDLHGANLMRGLLAHDPSCDIRFWGGGKMAAVGGTLVRDYRDNAVMGLI
EVIGRLGSILRNLRFCKKDILAWKPDAVILIDYPGFNLKIARFAHEHGFKVFYYIPPKVW
ARGEGRIRLLKKYVDRTFIIFPFEMPWFKSRGLDVIYNGNPLVDNIASTPSVHLTREEFL
RSHSLTDDGREIIAMLAGSRKMEVGYLLPRLVKTAAILKAKTGGRFRFLLAAAPSIDRSY
YAKYLDGNSDIEIIYGDTYGVLSHSAAAAISSGTASLEAAIIGTPQVVCYGMNPITYAIA
RTIVRLDTISLANMILGRHIFRELLQGDCTPEHIADELLRMTGDSEYRSRMLSDYKDMMA
LLGEKDPAMRTAADIERIIQEK

Enzyme Prediction     

No EC number prediction in MGYG000001774_00178.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	362	4.4e-111	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.59e-99	1	382	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.67e-96	1	375	2	374	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.76e-75	4	339	2	336	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.55e-69	5	380	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.84e-44	1	332	2	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53532.1	3.44e-127	1	381	1	376
ADY50863.1	1.38e-111	1	372	1	359
QEM12843.1	6.32e-111	1	372	1	360
AYL97782.1	8.38e-111	1	372	1	360
QKJ32584.1	1.15e-110	1	372	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.75e-40	5	358	11	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.22e-40	5	358	11	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	4.72e-78	5	368	8	370	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	1.02e-73	2	381	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	4.61e-72	2	350	8	351	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	9.17e-72	2	382	8	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	3.90e-70	2	379	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001774_00178.