CAZyme Information: MGYG000001775_00413

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum
• CAZyme ID: MGYG000001775_00413
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		38934.07	9.6376

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001775	2417274	MAG	Denmark	Europe

• Gene Location: Start: 17069; End: 18106 Strand: +

Full Sequence      

MNGRFLYISRNYKHPHCGGCVARTDIEKIMESMGYANIGLRRTFSSNGIVHSLRNVYGAL
RAMRQLRAGDVVVAQYQMKMFGRLCRIAHKRGAKVICLIHDLDSWRDKKLTPRQEMPLLN
MADVILTHNHAMRQWLEKQGCTAPMTDYEIMDYIHGVSGDPHGYPSDGKFSLFFVGNLSP
RLNGWIYDLAKEMPHRKIYLYGSEYDETLGHATPNLRMCGERPDTDIIASHKGDFGISWY
GISLDDGVGKVGEYMAINNPHKVGLYLRCNAPVVVWDKAGRAELIRKRGIGITVGSLRQL
DAALDAVTPADYSRMVDNVSAINIELKSGRFLKKALKRAMEIINK

Enzyme Prediction     

No EC number prediction in MGYG000001775_00413.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	18	340	3.4e-80	0.9658385093167702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.15e-64	18	343	16	333	sugar transferase.
cd03801	GT4_PimA-like	6.40e-07	50	229	58	263	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam13579	Glyco_trans_4_4	7.05e-05	48	143	52	149	Glycosyl transferase 4-like domain.
cd03794	GT4_WbuB-like	5.62e-04	85	294	116	344	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
pfam13439	Glyco_transf_4	7.44e-04	31	138	36	150	Glycosyltransferase Family 4.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43054.1	1.02e-126	7	345	6	344
ALJ61055.1	1.05e-73	7	343	5	342
QUT93412.1	1.05e-73	7	343	5	342
QQT78203.1	2.09e-73	7	339	4	335
QUU07104.1	2.09e-73	7	339	4	335

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	9.39e-28	19	341	15	325	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	1.06e-18	21	336	19	326	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
Q9AEU1	7.96e-17	21	344	19	334	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	1.31e-12	92	340	92	329	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	8.11e-12	92	340	97	334	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001775_00413.