CAZyme Information: MGYG000001775_00682

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum
• CAZyme ID: MGYG000001775_00682
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		35749.1	7.1256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001775	2417274	MAG	Denmark	Europe

• Gene Location: Start: 27308; End: 28219 Strand: +

Full Sequence      

MNASIDVIKKLLFWPKIKRRLIIRKHRAVSRFCRKLISDYESKPESHYLVTPLKNLNSDK
IIWQYWGQGFNNEMPELVRKCLDSVEKNHGEATIIRLSDETISEYLEIPDFVLEKKGLYP
KAIFSDLLRCMLLSAYGGCWLDATVLLSEKIPQKYWDADFFLFQRYESETNKKYWSNAFY
YYFGWENGFSVRVLNSIIFSQKNNPAITAITQLLLHFWNQHDNLPDYFFFQILFNELVKE
GRIGNCEIENDCIPHLLQQYINDPDFKLASLNDILSVTPFHKLTYKSTESQNKAIAIIDH
ITE

Enzyme Prediction     

No EC number prediction in MGYG000001775_00682.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	152	6.9e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05704	Caps_synth	1.00e-67	9	301	1	278	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam04488	Gly_transf_sug	0.006	75	142	1	74	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM12647.1	9.74e-92	14	285	13	287
QUT79403.1	1.18e-91	14	285	19	293
AAO77978.1	9.17e-88	6	285	5	290
QQA10594.1	9.17e-88	6	285	5	290
QMW89130.1	9.17e-88	6	285	5	290

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L0MZK0	3.56e-06	53	218	37	200	O-glycosyltransferase PaGT OS=Phomopsis amygdali OX=1214568 GN=PaGT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000093	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001775_00682.