CAZyme Information: MGYG000001777_01065

Basic Information

• Species: Eubacterium_F sp000434115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp000434115
• CAZyme ID: MGYG000001777_01065
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		35647.27	10.2451

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001777	2510144	MAG	Denmark	Europe

• Gene Location: Start: 27050; End: 28009 Strand: +

Full Sequence      

MKKWIWCSLITAAFLGLIFHADAGQAAKKCAPLQVQGTKIVNSKGKTVNLRGVSTHGIAW
FPQYVNKKAFRSFQKMGANTIRLALYSDPGAGYQKSLYSKVEEGVKAATDLGMYVILDWH
ILSDGNPKTNQSKAKEFFTYFSKKYAAQTNVIYEICNEPNGNVTWKKDIKPYAESMISLI
RQNDKDALIIVGTPTWSQDVDVVAYDPIQGQTNILYALHFYAATHGDGIRNKLIQAHKKN
LPVIVSEFSICDASGNGAINKKEAKKWMSLLKKYNIGRVAWSLCNKNETSALLKPSCKTT
TNIKKSHLSKTGKWIVKNW

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	44	278	2e-83	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	9.66e-70	41	287	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.00e-11	36	237	53	240	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	4.68e-04	67	182	27	158	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	8.56e-04	1	146	2	153	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM00780.1	2.70e-108	33	317	221	510
CBK83877.1	6.46e-107	33	315	234	523
QWT53734.1	8.62e-107	20	317	208	510
AFA47670.1	3.81e-104	33	317	205	496
QTU84139.1	6.63e-94	33	314	208	493

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XZW_A	1.58e-92	29	315	8	298	Endo-glucanasechimera C10 [uncultured bacterium]
3PZT_A	2.27e-90	29	318	33	323	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZB_A	3.01e-90	33	315	12	299	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
6GJF_A	4.24e-90	33	315	13	296	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
1H11_A	1.17e-73	22	315	1	296	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	1.57e-89	5	318	9	328	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	2.47e-88	5	318	9	328	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	1.95e-87	5	318	9	328	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P15704	9.29e-79	33	318	47	334	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
Q59394	3.58e-74	11	315	19	324	Endoglucanase N OS=Pectobacterium atrosepticum OX=29471 GN=celN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000495	0.998715	0.000286	0.000171	0.000157	0.000160

TMHMM  Annotations     

start	end
5	24