CAZyme Information: MGYG000001777_02078

Basic Information

• Species: Eubacterium_F sp000434115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp000434115
• CAZyme ID: MGYG000001777_02078
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748		86653.89	5.0468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001777	2510144	MAG	Denmark	Europe

• Gene Location: Start: 10055; End: 12301 Strand: +

Full Sequence      

MNEILKEWMNPQLIEEMEEGVINAPQDLLGMHFYEGTQMFVVRRPVAQRVWITDVSGETA
YEAEELDAELGLFGLQIEKKKDQLKDYRVRIQYGEGDVVETADPYAYEPEITDYDTYLFA
QGNHYEIFDKLGAHVETIDGVTGTRFAVWAPHARSVSVVGNFNMWDGRLHTMRLIGPSGI
YELFVPNVSEGAVYKYQITTRSGDLLFKTDPYGNYAQVRPDNASVVTSLTGYEWQDSDYE
KKHHAKTREVRERAPMNIYEAHLGSWKKRVEDDDNGFYSYRELAEMMGDYLVEMGYTHIE
LMGIAEYPFDGSWGYQVGCYYAPTSRYGTPKDFMYFVDEMHKRGIEVILDWVPAHFPKDA
HCLGNFDGQAVYEHSDRRRGEHPDWGTYIFDYGKKEVQNFLVANALFWIEKFHIDGLRVD
AVASMLYLDYGKQDGDWLPNKDGGNENYEAMDFLRHLNSIMEKRHPDAYIIAEESTAWPG
VTKRVEDDNGLGFSYKWNMGWMNDFLEYMKLDPYFKQFHHGQLCFSLSYYLSEKYILVLS
HDEVVHGKCSLLNKMPGLTGDKYAALKAAFGFFYGHPGKKLLFMGQEFAQEREWSEMRSL
DWFLLDQEPHQGIHAFIKDMNKLYLENDALYFNDSDVMGFEWMDCERAETSTVAFVRRGK
MTKKQLMFILNFTPVAHEQYTVKAPCGGTFREIINSDAPKYGGQGRLNESPIKAKKVTTV
KKKKEAAYELTCYLPPLSVVVLEYDYKK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	289	590	1.3e-148	0.9966777408637874
CBM48	130	216	3.2e-19	0.868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	109	744	5	627	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	9	737	503	1215	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	106	744	1	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14706	PRK14706	0.0	131	744	27	621	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	10	747	2	726	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL99342.1	0.0	1	746	1	738
CBK82088.1	0.0	1	746	1	740
QWT52740.1	0.0	1	746	1	738
BBF44560.1	0.0	1	747	1	739
ANV77640.1	2.68e-291	21	743	13	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GR2_A	1.49e-234	25	745	41	774	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQZ_A	2.99e-234	25	745	41	774	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	4.23e-234	25	745	41	774	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	4.23e-234	25	745	41	774	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	5.98e-234	25	745	41	774	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P30539	1.80e-245	111	748	7	636	1,4-alpha-glucan branching enzyme GlgB OS=Butyrivibrio fibrisolvens OX=831 GN=glgB PE=1 SV=1
Q8DLB8	8.85e-245	9	748	3	754	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q1AZ86	4.80e-241	25	742	18	717	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q5N4W5	1.97e-240	25	743	28	758	1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) OX=269084 GN=glgB PE=3 SV=1
P16954	1.97e-240	25	743	28	758	1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=glgB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000093	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001777_02078.