CAZyme Information: MGYG000001777_02288

Basic Information

• Species: Eubacterium_F sp000434115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp000434115
• CAZyme ID: MGYG000001777_02288
• CAZy Family: GT4
• CAZyme Description: Putative glycosyltransferase EpsF

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		36066.28	6.893

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001777	2510144	MAG	Denmark	Europe

• Gene Location: Start: 3302; End: 4261 Strand: -

Full Sequence      

MGGNIYHTPGLNPAKYPSYLKCMKKIFEENPEYKIVEAHNGALGVYALHAAKVNHIPVRI
FHAHGASITRDWKLPIKLVCKALLPSNMNQHFSCGIEAARCYFGEKVVERNDYELIPNAI
EVNRFVFDSTIRNRIRHDNHLENKHIVGHVGRFMSQKNHTFLLDVFAEVSKRDSLAHLVL
LGDGELMDAMKEKASNLGIKDRVTFVGNVGNANEWYQAFDCFVLPSVWEGLPVVGVEAQA
ADLPCIFSSAVTREIGLSDRAKFIPLTEEISTWATEICNALQQNVRNDNTKLITEHHYNI
EIEAKKLQERYLQLAGEVE

Enzyme Prediction     

No EC number prediction in MGYG000001777_02288.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	140	285	1.1e-28	0.925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03812	GT4_CapH-like	4.19e-79	1	314	51	356	capsular polysaccharide biosynthesis glycosyltransferase CapH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. capH in Staphylococcus aureus has been shown to be required for the biosynthesis of the type 1 capsular polysaccharide (CP1).
cd03811	GT4_GT28_WabH-like	2.98e-36	24	302	76	344	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03808	GT4_CapM-like	2.00e-35	10	246	60	291	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03807	GT4_WbnK-like	2.66e-32	6	249	54	295	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
pfam13692	Glyco_trans_1_4	1.44e-26	144	259	1	110	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ63611.1	3.29e-158	1	317	43	359
CBL39379.1	5.94e-154	1	317	53	368
QTE67967.1	7.02e-95	1	314	53	366
QUC65852.1	1.60e-93	1	314	53	366
QTE70570.1	2.58e-92	1	314	53	366

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71055	9.67e-45	1	280	57	341	Putative glycosyltransferase EpsF OS=Bacillus subtilis (strain 168) OX=224308 GN=epsF PE=2 SV=1
Q58459	2.71e-15	110	263	168	328	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1
Q04975	8.32e-12	147	250	401	504	Vi polysaccharide biosynthesis protein VipC/TviE OS=Salmonella typhi OX=90370 GN=vipC PE=4 SV=2
A7TZT2	5.46e-11	108	246	214	362	Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mfpsA PE=1 SV=1
O05083	9.84e-11	141	246	179	283	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001777_02288.