CAZyme Information: MGYG000001779_00563

Basic Information

• Species: UMGS1851 sp900555605
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1851; UMGS1851 sp900555605
• CAZyme ID: MGYG000001779_00563
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	MGYG000001779_10|CGC1	96755.42	5.9051

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001779	2685015	MAG	Denmark	Europe

• Gene Location: Start: 13938; End: 16535 Strand: +

Full Sequence      

MLQPYQFRVDYGKLQHDSRFRITDSKTPVISWAVMSDRPDSYQTAYRIAFSSSDKMLWQT
DWIESAKQETVYAGPPLPFGCRIYFTVEIKDQQGSVSEKAGDYFYCGQTDHWEAGWIAAS
VQASRRAVCFQKSFMITKPILSAYCMVCGLGYHKIKLNGKAPDPSLLDPAHADYSQVCYY
VLLPEIESTLREGENEISIEIGDGWRHLDSAFIKSNIGDRKLSFDGVPQVSAMFRILYTD
GTSDTIMTDETWSWSHTPILSNNIYDGTIYDANSTAQPDTRAALPTHAASAKQPACAVPS
PLQPGAQYGMRVQTLEPIREKEVYHPLSVTQLEGPDGLPRYLVDFGQNIAGIVRLKLPER
MQAGQTIQIVHGEFLDEDGSIYTAPLREAKCTDIYIASGDGRDLAQWQPEFTYHGFRYIQ
VDGYGSILKKSAVTAIAIYTDIQSESFFTCGSALINQIHKNAVQTEKSNIHSILTDCPQR
NERLGWMNDATVRFEETPYNFDIGRIFPKVVRDLICVQDGSGAITCTAPFVVGGRPADPV
CSSFLVAGMQAAMHTGNLAILKEAYPHYKAWQQCLLDHSDGYIVNYSYYGDWAGPSYACH
SEEIAVSAVTPGILISTGYSYLNCLLLSKMAGFLSYKQEQADYEQLAAQIRSAFLKKWFD
PESARVDAGSQASQAFALWLGLIPEAYTQKAADLIHADLTARHYQITTGNLCTRYLMDVL
AQYGYIDDAYAIITRETYPSIGYMIQNEATTIWERFELKKNPDMNSHNHPMYGAVDYWFY
AYLCGIRPTAPGWEAAEIKPYYPSQLLSAHASVDTVKGPITVKWVKRYGALHLYVSVPFG
VTAEIHTKDGIVKAGSGTHHYTWPL

Enzyme Prediction     

No EC number prediction in MGYG000001779_00563.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	340	846	4.4e-141	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.48e-85	446	783	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	2.61e-33	335	439	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.21e-27	138	322	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	4.12e-16	785	861	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	1.08e-164	24	852	49	856
VEH16339.1	3.06e-160	27	849	51	857
QEC51112.1	1.33e-152	26	846	88	894
AEF82974.1	1.59e-149	25	845	28	839
AHF90970.1	5.04e-138	24	850	23	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.87e-131	24	855	47	910	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.66e-93	108	865	270	1032	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.04e-78	28	861	23	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.65e-92	108	862	270	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.49e-88	28	845	55	876	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	2.69e-87	3	845	24	904	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.94e-79	27	844	50	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001779_00563.