CAZyme Information: MGYG000001779_01478

Basic Information

• Species: UMGS1851 sp900555605
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1851; UMGS1851 sp900555605
• CAZyme ID: MGYG000001779_01478
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
916	MGYG000001779_50|CGC1	101593.69	4.4993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001779	2685015	MAG	Denmark	Europe

• Gene Location: Start: 3342; End: 6092 Strand: -

Full Sequence      

MKRKHMILMLTGFCLSLVLAGACTGAKKKQALNPPKADLVLSRAAQRDAAFAQLPLGAVR
ASSWLERQLRLQAEHITGDFESLCPDVQTEGEDRSGWLGGSGEAWERGPYYVKGLVALAY
TLSDDVLIAKCQRWIDAAIESQTESGAFGPYADTPDKLDWWSLMPMVSAIEYYYDATAET
KADPRVIPFLEKYFAFQAKALNKKPLTDWAKARAGDNIDSIYWLYLKNGDESLLRLCRRM
YAQTDWKTIYTEDRWSGTYHIVNTHQSFKLLPLMYAITGEQDYLKSYYKGLLYLDVESGR
ADGMSNGDELTGTISATCGTETCAVAERMLSDEIALRITGDSSIADHLELIAYNVWPSQL
TEQITGQVYFTMQNQVTAVLGPHGFSSDGGDRAVYGTPGGYPCCSCNFHMGWPLFVSSMW
MRTTDGGIAAGAYGPNEVTFTGGGAQVRIVQETDYPFRNTVNLTIHMEGACTFPIYLRVP
EWCSTPEVYVNGVQQALPAGDGYFCLQASWCDNDRIQLVFPETIKASYSENNSVFVRRGA
LLYTLGLAENTEKIDYNPNQWTLTEKYTSVNLTPAEDWSYALSDFDIHNAETFFTVSERE
IKTDMTFAKEQAPIVLQGKAVLVKDWGLREDQVAQRVPLSPISPEQCEGEIVEVALIPYG
FARLRVTLLPWTGDTPVYFTPDETDSDIMTFYRVTVPYTGEEGATAMSLIQRPVQLTYTA
PEDMTAKLFINGEEMDTLRLKKNENIYVSEALRIDPSKYNLVELRTAEDGENLRNLSGVS
LCFGEAEAYGICLEAEYAELSGSAYKSGAYVAGIDDTGSSLHFPSIRIPSAGVWTVRVYY
AAAAGKATHTLLLDGQPCGVISYAATDRWGVFRNDTYAELTITAEAGSHSFTILKAASDI
GFAELERIELIQIKDA

Enzyme Prediction     

No EC number prediction in MGYG000001779_01478.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	318	542	4.3e-27	0.4255725190839695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.68e-41	110	543	62	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.27e-17	224	543	240	495	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04086	CBM35_mannanase-like	2.80e-09	791	895	1	106	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
cd04083	CBM35_Lmo2446-like	8.90e-08	794	910	4	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd02795	CBM6-CBM35-CBM36_like	1.36e-07	793	910	2	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE95537.1	2.29e-129	51	687	40	666
QPH39723.1	3.32e-127	31	673	18	650
QIL41453.1	1.79e-126	51	686	38	662
ACU60445.1	2.56e-126	16	691	4	673
ARS39276.1	4.78e-126	51	673	38	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	2.33e-13	253	555	289	620	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	5.94e-12	444	559	452	569	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.03e-11	444	559	452	569	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000005	0.000127	0.999906	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	26