CAZyme Information: MGYG000001780_00098

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_00098
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000001780_1|CGC3	29383.3	9.2819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 105646; End: 106386 Strand: +

Full Sequence      

MIPKIIHYCWLSGDPIPAKFQKCMDSWKKFLPDYEFMLWDLNRFDINQTQWVKQAFVSKK
YAFAADYIRLYAVYTYGGIYLDMDVEVIRNLNELLMHPYLLGMESKESIEAGVFGATLHN
EYIKMCLEYYENRSFIKVDGSYDMLPLPRIMYKVLNEHYTVKDRKAISIEESSDMVSLFP
LEYLTAKSHRTGELMITHNTYTIHHFAGSWVPKSYILKKRIYQLISRNKIMFWIYKNTYG
KLKKQR

Enzyme Prediction     

No EC number prediction in MGYG000001780_00098.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	95	3.5e-22	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.24e-18	1	99	81	182	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	4.51e-16	17	101	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	6.26e-07	1	82	45	131	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.005	4	49	1	46	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.008	47	84	156	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT44427.1	7.23e-104	1	228	1	228
ALJ04028.1	7.06e-85	1	214	1	219
AEF84277.1	1.27e-78	1	221	1	209
AXV49987.1	1.41e-77	1	241	1	246
QUB93573.1	2.00e-77	1	241	1	246

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	3.44e-12	2	115	57	173	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
Q9UT67	1.71e-10	1	134	81	217	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
P38287	1.54e-09	1	136	61	202	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
P33300	2.10e-09	1	136	54	195	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
Q5UQW4	3.11e-06	1	95	1	101	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_00098.