CAZyme Information: MGYG000001780_00302

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_00302
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000001780_2|CGC3	43041.37	6.8458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 84671; End: 85795 Strand: +

Full Sequence      

MKKPFLLIFFFLITVMQVVGQQNFDKVAIKSIMKRVADWQIANPNKGAEHDDLDWTHAAL
YMGMLDWAELAEKEDGDDSYYQWLLRIGRRNHFQVGKWMYHADFIAVGQPFIDLYNKYGN
KKMIAPVMARANWIVENPAETTLELDYGKLETLDRWSWCDALFMAPPVYAKLYALTKDKK
YLDFLNKEYKATYDYLYDKEEHLFYRDRRYFAKREANGKKVFWGRGNGWVLGGLAEILQV
LPRTEPSRAFYQDLFVTLATRVAGLQSPDGYWHASLLDPASYPSPETSATGFIVYALAYG
VNEGLLDKKTFMPVIEKGWQALVDAVEPTGKLGYVQPIGADPRKVTRDMTEVYGVGAFLL
SGCQIYNQLSNHEK

Enzyme Prediction     

No EC number prediction in MGYG000001780_00302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	366	3.3e-86	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.56e-100	32	366	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	9.72e-53	18	360	5	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59360.1	3.40e-253	1	366	1	366
QUT89583.1	3.40e-253	1	366	1	366
AVM53966.1	5.42e-236	1	366	1	363
QDO67620.1	6.69e-231	22	370	24	372
QUT90811.1	2.81e-199	20	369	19	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.33e-68	24	365	24	366	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	7.35e-64	39	364	44	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.10e-51	65	364	65	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	7.30e-11	158	361	141	360	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.98e-10	158	361	131	350	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	4.17e-72	20	365	25	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	3.84e-69	28	365	52	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	8.84e-68	24	365	31	373	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O34559	3.99e-10	158	361	141	360	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000270	0.999093	0.000163	0.000157	0.000151	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_00302.