CAZyme Information: MGYG000001780_00303

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_00303
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704	MGYG000001780_2|CGC3	81404.19	7.1428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 85785; End: 87899 Strand: +

Full Sequence      

MKNNVLFLLIVLLMSGISGKMEAREVVSFNDGWEFKKGPFSKDAMQAVQKWNTDWQEVTI
PHTWNADDMQKKVSAFYEGVAYYRKKCTFPDNMEGKRIFLRFEGVGSCAEVYINGYLAGT
HKGAYSAFVCEIGSQVKFGEENEIVVKADNASRPDVIPTNHILFGVYGGIYRPVWLIVTE
PCNIVVNDCASSGVYITQKNVSKKSAEVTVKVKVDNATMAPALLELENTVYDMNGKLVKK
HSQSFELTPQGVQNYISHFRLNNPHLWQGREDPYLHKVVSRLMQNGRVIDEIVQPLGLRN
YEVVAGKGFFLNGKRYPMYGVTRHQDWWGLGSALTNKEHDFDLAQIMDIGATTVRFAHYQ
QSDYIYSRCDTLGLVIWAEIPFVNRVTGQEWDNAHQQMRELIRQSFNHPSIYVWGIHNEV
YHPHGYTAALTQSIHDLCKLEDPDRYTVSVNGYGHANHPVNQNADIQGMNRYFGWYERKV
QDIKPWIEKMEQEYPWQRLMLTEYGADANIKHQTEILGDALNWTSPFYPETFQTKTHEYQ
WSIIAQHPYIIASYLWNMFDFAVPTSKRGSVDARNMKGMMTFDRKIKKDSYFWYKANWSK
EPVVYLTQRRNVEREKKETTVTVYSNMGAPKVYLNGRELTGVRKGYTDVHYIFDNVVLND
GKNVLKAIVSHQGQEHTDEIEWMYNGECKRTADSLEYEKEHGSW

Enzyme Prediction     

No EC number prediction in MGYG000001780_00303.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	21	603	3.1e-90	0.6210106382978723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	2.71e-56	22	602	8	596	beta-D-glucuronidase; Provisional
COG3250	LacZ	4.11e-44	24	423	10	410	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.55e-29	54	445	70	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	3.36e-20	304	600	3	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	6.34e-17	28	179	3	168	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59361.1	0.0	1	704	1	704
QUT89582.1	0.0	1	704	1	704
AVM52257.1	0.0	1	704	1	704
QRO23471.1	0.0	20	704	35	719
QDO67619.1	0.0	23	704	23	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FN9_A	0.0	23	701	4	682	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5Z1A_A	1.43e-136	19	680	18	670	Thecrystal structure of Bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine [Bacteroides fragilis NCTC 9343]
3CMG_A	7.65e-136	21	680	1	651	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6MVG_A	7.26e-120	24	668	25	644	Crystalstructure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_B Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_C Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus]
6MVH_A	9.65e-117	24	675	25	651	Crystalstructure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_B Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_C Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_D Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	1.15e-81	3	668	24	703	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	3.44e-57	24	662	26	664	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	2.05e-47	18	650	36	706	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	4.74e-46	24	437	3	406	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	1.85e-43	10	639	31	664	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000843	0.399058	0.599591	0.000210	0.000156	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_00303.